Placeholder image of a protein
Icon representing a puzzle

1385: Revisiting Puzzle 113: White Birch

Closed since almost 9 years ago

Intermediate Overall Prediction

Summary

Created
May 31, 2017
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein is an allergen produced by the white birch tree. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


ADDHPQDKAERERIFKRFDANGDGKISAAELGEALKTLGSITPDEVKHMMAEIDTDGDGFISFQEFTDFGRANRGLLKDVAKIF

Top groups

  1. Avatar for Russian team 11. Russian team 1 pt. 9,151
  2. Avatar for xkcd 12. xkcd 1 pt. 9,043
  3. Avatar for Natural Abilities 13. Natural Abilities 1 pt. 9,028
  4. Avatar for Richard Dawkins Foundation 14. Richard Dawkins Foundation 1 pt. 8,764
  1. Avatar for Simek 41. Simek Lv 1 21 pts. 9,360
  2. Avatar for joremen 42. joremen Lv 1 20 pts. 9,357
  3. Avatar for Timo van der Laan 43. Timo van der Laan Lv 1 19 pts. 9,357
  4. Avatar for deLaCeiba 44. deLaCeiba Lv 1 18 pts. 9,356
  5. Avatar for carsonfb 45. carsonfb Lv 1 17 pts. 9,356
  6. Avatar for manu8170 46. manu8170 Lv 1 17 pts. 9,346
  7. Avatar for Deleted player 47. Deleted player pts. 9,343
  8. Avatar for Vinara 48. Vinara Lv 1 15 pts. 9,332
  9. Avatar for weitzen 49. weitzen Lv 1 14 pts. 9,329
  10. Avatar for isaksson 50. isaksson Lv 1 14 pts. 9,324

Comments