Placeholder image of a protein
Icon representing a puzzle

1385: Revisiting Puzzle 113: White Birch

Closed since almost 9 years ago

Intermediate Intermediate Overall Overall Prediction Prediction

Summary


Created
May 31, 2017
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein is an allergen produced by the white birch tree. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


ADDHPQDKAERERIFKRFDANGDGKISAAELGEALKTLGSITPDEVKHMMAEIDTDGDGFISFQEFTDFGRANRGLLKDVAKIF

Top groups


  1. Avatar for Russian team 11. Russian team 1 pt. 9,151
  2. Avatar for xkcd 12. xkcd 1 pt. 9,043
  3. Avatar for Natural Abilities 13. Natural Abilities 1 pt. 9,028

  1. Avatar for Blipperman 51. Blipperman Lv 1 13 pts. 9,314
  2. Avatar for YeshuaLives 52. YeshuaLives Lv 1 12 pts. 9,312
  3. Avatar for dssb 53. dssb Lv 1 12 pts. 9,311
  4. Avatar for WBarme1234 54. WBarme1234 Lv 1 11 pts. 9,308
  5. Avatar for SKSbell 55. SKSbell Lv 1 11 pts. 9,308
  6. Avatar for Glen B 56. Glen B Lv 1 10 pts. 9,306
  7. Avatar for Merf 57. Merf Lv 1 10 pts. 9,299
  8. Avatar for toshiue 58. toshiue Lv 1 9 pts. 9,299
  9. Avatar for MicElephant 59. MicElephant Lv 1 9 pts. 9,292
  10. Avatar for georg137 60. georg137 Lv 1 8 pts. 9,291

Comments