Placeholder image of a protein
Icon representing a puzzle

1385: Revisiting Puzzle 113: White Birch

Closed since almost 9 years ago

Intermediate Overall Prediction

Summary

Created
May 31, 2017
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein is an allergen produced by the white birch tree. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


ADDHPQDKAERERIFKRFDANGDGKISAAELGEALKTLGSITPDEVKHMMAEIDTDGDGFISFQEFTDFGRANRGLLKDVAKIF

Top groups

  1. Avatar for Russian team 11. Russian team 1 pt. 9,151
  2. Avatar for xkcd 12. xkcd 1 pt. 9,043
  3. Avatar for Natural Abilities 13. Natural Abilities 1 pt. 9,028
  4. Avatar for Richard Dawkins Foundation 14. Richard Dawkins Foundation 1 pt. 8,764
  1. Avatar for johngran 61. johngran Lv 1 8 pts. 9,274
  2. Avatar for lupussapien 62. lupussapien Lv 1 7 pts. 9,274
  3. Avatar for froggs554 63. froggs554 Lv 1 7 pts. 9,272
  4. Avatar for spritz1992 64. spritz1992 Lv 1 7 pts. 9,259
  5. Avatar for dbuske 65. dbuske Lv 1 6 pts. 9,244
  6. Avatar for bcre8tvv 66. bcre8tvv Lv 1 6 pts. 9,232
  7. Avatar for Deleted player 67. Deleted player pts. 9,231
  8. Avatar for altejoh 68. altejoh Lv 1 5 pts. 9,230
  9. Avatar for dizzywings 69. dizzywings Lv 1 5 pts. 9,217
  10. Avatar for ppp6 70. ppp6 Lv 1 5 pts. 9,215

Comments