Placeholder image of a protein
Icon representing a puzzle

1385: Revisiting Puzzle 113: White Birch

Closed since almost 9 years ago

Intermediate Overall Prediction

Summary

Created
May 31, 2017
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein is an allergen produced by the white birch tree. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


ADDHPQDKAERERIFKRFDANGDGKISAAELGEALKTLGSITPDEVKHMMAEIDTDGDGFISFQEFTDFGRANRGLLKDVAKIF

Top groups

  1. Avatar for Russian team 11. Russian team 1 pt. 9,151
  2. Avatar for xkcd 12. xkcd 1 pt. 9,043
  3. Avatar for Natural Abilities 13. Natural Abilities 1 pt. 9,028
  4. Avatar for Richard Dawkins Foundation 14. Richard Dawkins Foundation 1 pt. 8,764
  1. Avatar for ralan-nsk 81. ralan-nsk Lv 1 2 pts. 9,151
  2. Avatar for DScott 82. DScott Lv 1 2 pts. 9,147
  3. Avatar for Superphosphate 83. Superphosphate Lv 1 2 pts. 9,146
  4. Avatar for SouperGenious 84. SouperGenious Lv 1 2 pts. 9,140
  5. Avatar for 181818 85. 181818 Lv 1 2 pts. 9,138
  6. Avatar for tomespen 86. tomespen Lv 1 2 pts. 9,126
  7. Avatar for DAMilwaukeeWisconsin 87. DAMilwaukeeWisconsin Lv 1 2 pts. 9,113
  8. Avatar for mitarcher 88. mitarcher Lv 1 2 pts. 9,106
  9. Avatar for fpc 89. fpc Lv 1 2 pts. 9,084
  10. Avatar for j.wohlmann 90. j.wohlmann Lv 1 1 pt. 9,074

Comments