Placeholder image of a protein
Icon representing a puzzle

1385: Revisiting Puzzle 113: White Birch

Closed since almost 9 years ago

Intermediate Overall Prediction

Summary

Created
May 31, 2017
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein is an allergen produced by the white birch tree. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


ADDHPQDKAERERIFKRFDANGDGKISAAELGEALKTLGSITPDEVKHMMAEIDTDGDGFISFQEFTDFGRANRGLLKDVAKIF

Top groups

  1. Avatar for Beta Folders
    1. Beta Folders
    100 pts. 9,582
  2. Avatar for Anthropic Dreams 2. Anthropic Dreams 68 pts. 9,553
  3. Avatar for Go Science 3. Go Science 44 pts. 9,542
  4. Avatar for Contenders 4. Contenders 27 pts. 9,541
  5. Avatar for HMT heritage 5. HMT heritage 16 pts. 9,496
  6. Avatar for Gargleblasters 6. Gargleblasters 9 pts. 9,485
  7. Avatar for L'Alliance Francophone 7. L'Alliance Francophone 5 pts. 9,462
  8. Avatar for Void Crushers 8. Void Crushers 3 pts. 9,400
  9. Avatar for Italiani Al Lavoro 9. Italiani Al Lavoro 1 pt. 9,356
  10. Avatar for freefolder 10. freefolder 1 pt. 9,199
  1. Avatar for gitwut 11. gitwut Lv 1 71 pts. 9,515
  2. Avatar for smilingone 12. smilingone Lv 1 68 pts. 9,511
  3. Avatar for mimi 13. mimi Lv 1 66 pts. 9,509
  4. Avatar for caglar 14. caglar Lv 1 63 pts. 9,506
  5. Avatar for eusair 15. eusair Lv 1 61 pts. 9,505
  6. Avatar for O Seki To 16. O Seki To Lv 1 59 pts. 9,496
  7. Avatar for Bruno Kestemont 17. Bruno Kestemont Lv 1 57 pts. 9,492
  8. Avatar for fiendish_ghoul 18. fiendish_ghoul Lv 1 55 pts. 9,483
  9. Avatar for actiasluna 19. actiasluna Lv 1 53 pts. 9,476
  10. Avatar for Museka 20. Museka Lv 1 51 pts. 9,462

Comments