Placeholder image of a protein
Icon representing a puzzle

1387: Unsolved De-novo Freestyle 106

Closed since almost 9 years ago

Intermediate Intermediate Intermediate Intermediate Intermediate Intermediate Intermediate Intermediate Intermediate Overall Overall Overall Overall Overall Overall Overall Overall Overall Prediction Prediction Prediction Prediction Prediction Prediction Prediction Prediction Prediction

Summary


Created
June 06, 2017
Expires
Max points
100
Description

The structure of this protein is still unknown. Secondary structure predictions (from PSIPRED) are marked on the starting structure, and provide clues about where the protein might form helices and sheets!



Sequence:


SEFQKEMKKLEETLKKGDEETFRELLKELEKRVREHGREDYKEILKRLREYLEKGDKESLQRLFEETKKS

Top groups


  1. Avatar for Russian team 11. Russian team 2 pts. 9,197
  2. Avatar for Natural Abilities 12. Natural Abilities 1 pt. 9,147
  3. Avatar for xkcd 13. xkcd 1 pt. 9,101
  4. Avatar for freefolder 14. freefolder 1 pt. 8,968
  5. Avatar for FoldIt@Netherlands 16. FoldIt@Netherlands 1 pt. 7,386
  6. Avatar for Team South Africa 17. Team South Africa 1 pt. 7,037
  7. Avatar for DSN @ Home 18. DSN @ Home 1 pt. 0

  1. Avatar for Wilm
    1. Wilm Lv 1
    100 pts. 9,738
  2. Avatar for anthion 2. anthion Lv 1 97 pts. 9,732
  3. Avatar for eusair 3. eusair Lv 1 94 pts. 9,732
  4. Avatar for LociOiling 4. LociOiling Lv 1 91 pts. 9,728
  5. Avatar for fiendish_ghoul 5. fiendish_ghoul Lv 1 88 pts. 9,717
  6. Avatar for caglar 6. caglar Lv 1 86 pts. 9,715
  7. Avatar for markm457 7. markm457 Lv 1 83 pts. 9,714
  8. Avatar for Galaxie 8. Galaxie Lv 1 80 pts. 9,709
  9. Avatar for ZeroLeak7 9. ZeroLeak7 Lv 1 78 pts. 9,709
  10. Avatar for tokens 10. tokens Lv 1 75 pts. 9,704

Comments