Placeholder image of a protein
Icon representing a puzzle

1387: Unsolved De-novo Freestyle 106

Closed since almost 9 years ago

Intermediate Intermediate Intermediate Intermediate Intermediate Intermediate Intermediate Intermediate Intermediate Intermediate Overall Overall Overall Overall Overall Overall Overall Overall Overall Overall Prediction Prediction Prediction Prediction Prediction Prediction Prediction Prediction Prediction Prediction

Summary


Created
June 06, 2017
Expires
Max points
100
Description

The structure of this protein is still unknown. Secondary structure predictions (from PSIPRED) are marked on the starting structure, and provide clues about where the protein might form helices and sheets!



Sequence:


SEFQKEMKKLEETLKKGDEETFRELLKELEKRVREHGREDYKEILKRLREYLEKGDKESLQRLFEETKKS

Top groups


  1. Avatar for Go Science 100 pts. 9,758
  2. Avatar for Gargleblasters 2. Gargleblasters 74 pts. 9,732
  3. Avatar for Beta Folders 3. Beta Folders 54 pts. 9,731
  4. Avatar for Anthropic Dreams 4. Anthropic Dreams 38 pts. 9,721
  5. Avatar for Contenders 5. Contenders 27 pts. 9,678
  6. Avatar for Void Crushers 6. Void Crushers 18 pts. 9,468
  7. Avatar for L'Alliance Francophone 7. L'Alliance Francophone 12 pts. 9,464
  8. Avatar for Marvin's bunch 8. Marvin's bunch 8 pts. 9,365
  9. Avatar for HMT heritage 9. HMT heritage 5 pts. 9,338
  10. Avatar for Italiani Al Lavoro 10. Italiani Al Lavoro 3 pts. 9,223

  1. Avatar for Wilm
    1. Wilm Lv 1
    100 pts. 9,738
  2. Avatar for anthion 2. anthion Lv 1 97 pts. 9,732
  3. Avatar for eusair 3. eusair Lv 1 94 pts. 9,732
  4. Avatar for LociOiling 4. LociOiling Lv 1 91 pts. 9,728
  5. Avatar for fiendish_ghoul 5. fiendish_ghoul Lv 1 88 pts. 9,717
  6. Avatar for caglar 6. caglar Lv 1 86 pts. 9,715
  7. Avatar for markm457 7. markm457 Lv 1 83 pts. 9,714
  8. Avatar for Galaxie 8. Galaxie Lv 1 80 pts. 9,709
  9. Avatar for ZeroLeak7 9. ZeroLeak7 Lv 1 78 pts. 9,709
  10. Avatar for tokens 10. tokens Lv 1 75 pts. 9,704

Comments