Placeholder image of a protein
Icon representing a puzzle

1387: Unsolved De-novo Freestyle 106

Closed since almost 9 years ago

Intermediate Overall Prediction

Summary


Created
June 06, 2017
Expires
Max points
100
Description

The structure of this protein is still unknown. Secondary structure predictions (from PSIPRED) are marked on the starting structure, and provide clues about where the protein might form helices and sheets!



Sequence:


SEFQKEMKKLEETLKKGDEETFRELLKELEKRVREHGREDYKEILKRLREYLEKGDKESLQRLFEETKKS

Top groups


  1. Avatar for Russian team 11. Russian team 2 pts. 9,197
  2. Avatar for Natural Abilities 12. Natural Abilities 1 pt. 9,147
  3. Avatar for xkcd 13. xkcd 1 pt. 9,101
  4. Avatar for freefolder 14. freefolder 1 pt. 8,968
  5. Avatar for FoldIt@Netherlands 16. FoldIt@Netherlands 1 pt. 7,386
  6. Avatar for Team South Africa 17. Team South Africa 1 pt. 7,037
  7. Avatar for DSN @ Home 18. DSN @ Home 1 pt. 0

  1. Avatar for Bruno Kestemont
    1. Bruno Kestemont Lv 1
    100 pts. 9,758
  2. Avatar for jeff101 2. jeff101 Lv 1 86 pts. 9,757
  3. Avatar for isaksson 3. isaksson Lv 1 74 pts. 9,757
  4. Avatar for toshiue 4. toshiue Lv 1 63 pts. 9,756
  5. Avatar for NinjaGreg 5. NinjaGreg Lv 1 53 pts. 9,754
  6. Avatar for Hollinas 6. Hollinas Lv 1 44 pts. 9,738
  7. Avatar for ZeroLeak7 7. ZeroLeak7 Lv 1 37 pts. 9,733
  8. Avatar for Deleted player 8. Deleted player pts. 9,731
  9. Avatar for LociOiling 9. LociOiling Lv 1 25 pts. 9,731
  10. Avatar for Skippysk8s 10. Skippysk8s Lv 1 21 pts. 9,730

Comments