Placeholder image of a protein
Icon representing a puzzle

1387: Unsolved De-novo Freestyle 106

Closed since almost 9 years ago

Intermediate Overall Prediction

Summary

Created
June 06, 2017
Expires
Max points
100
Description

The structure of this protein is still unknown. Secondary structure predictions (from PSIPRED) are marked on the starting structure, and provide clues about where the protein might form helices and sheets!



Sequence:


SEFQKEMKKLEETLKKGDEETFRELLKELEKRVREHGREDYKEILKRLREYLEKGDKESLQRLFEETKKS

Top groups

  1. Avatar for Go Science
    1. Go Science
    100 pts. 9,758
  2. Avatar for Gargleblasters 2. Gargleblasters 74 pts. 9,732
  3. Avatar for Beta Folders 3. Beta Folders 54 pts. 9,731
  4. Avatar for Anthropic Dreams 4. Anthropic Dreams 38 pts. 9,721
  5. Avatar for Contenders 5. Contenders 27 pts. 9,678
  6. Avatar for Void Crushers 6. Void Crushers 18 pts. 9,468
  7. Avatar for L'Alliance Francophone 7. L'Alliance Francophone 12 pts. 9,464
  8. Avatar for Marvin's bunch 8. Marvin's bunch 8 pts. 9,365
  9. Avatar for HMT heritage 9. HMT heritage 5 pts. 9,338
  10. Avatar for Italiani Al Lavoro 10. Italiani Al Lavoro 3 pts. 9,223
  1. Avatar for reefyrob 11. reefyrob Lv 1 17 pts. 9,728
  2. Avatar for retiredmichael 12. retiredmichael Lv 1 14 pts. 9,725
  3. Avatar for Blipperman 13. Blipperman Lv 1 11 pts. 9,725
  4. Avatar for anthion 14. anthion Lv 1 9 pts. 9,723
  5. Avatar for ManVsYard 15. ManVsYard Lv 1 7 pts. 9,722
  6. Avatar for smholst 16. smholst Lv 1 5 pts. 9,722
  7. Avatar for Norrjane 17. Norrjane Lv 1 4 pts. 9,722
  8. Avatar for Galaxie 18. Galaxie Lv 1 3 pts. 9,721
  9. Avatar for smilingone 19. smilingone Lv 1 2 pts. 9,715
  10. Avatar for lamoille 20. lamoille Lv 1 2 pts. 9,715

Comments