Placeholder image of a protein
Icon representing a puzzle

1388: Revisiting Puzzle 114: Black Mamba

Closed since almost 9 years ago

Intermediate Overall Prediction

Summary

Created
June 07, 2017
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This toxin is produced in the intestines of the African black mamba. The protein contains ten cysteines that oxidize to form five disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


AVITGACERDLQCGKGTCCAVSLWIKSVRVCTPVGTSGEDCHPASHKIPFSGQRMHHTCPCAPNLACVQTSPKKFKCLSK

Top groups

  1. Avatar for Russian team 11. Russian team 3 pts. 9,848
  2. Avatar for Natural Abilities 12. Natural Abilities 2 pts. 9,829
  3. Avatar for Richard Dawkins Foundation 13. Richard Dawkins Foundation 1 pt. 9,510
  4. Avatar for xkcd 14. xkcd 1 pt. 9,284
  5. Avatar for Piratenpartei Deutschland 15. Piratenpartei Deutschland 1 pt. 9,021
  6. Avatar for freefolder 16. freefolder 1 pt. 8,724
  7. Avatar for FoldIt@Netherlands 17. FoldIt@Netherlands 1 pt. 8,602
  8. Avatar for GUGITBIOTECH 18. GUGITBIOTECH 1 pt. 8,598
  9. Avatar for UWO CHEM365 S2017 19. UWO CHEM365 S2017 1 pt. 7,949
  10. Avatar for Team South Africa 20. Team South Africa 1 pt. 6,902
  1. Avatar for Galaxie
    1. Galaxie Lv 1
    100 pts. 10,297
  2. Avatar for gmn 2. gmn Lv 1 83 pts. 10,284
  3. Avatar for alwen 3. alwen Lv 1 68 pts. 10,266
  4. Avatar for jamiexq 4. jamiexq Lv 1 55 pts. 10,264
  5. Avatar for alcor29 5. alcor29 Lv 1 44 pts. 10,260
  6. Avatar for reefyrob 6. reefyrob Lv 1 35 pts. 10,248
  7. Avatar for LociOiling 7. LociOiling Lv 1 27 pts. 10,248
  8. Avatar for smilingone 8. smilingone Lv 1 21 pts. 10,240
  9. Avatar for Bletchley Park 9. Bletchley Park Lv 1 16 pts. 10,221
  10. Avatar for gitwut 10. gitwut Lv 1 12 pts. 10,214

Comments