Placeholder image of a protein
Icon representing a puzzle

1388: Revisiting Puzzle 114: Black Mamba

Closed since almost 9 years ago

Intermediate Overall Prediction

Summary


Created
June 07, 2017
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This toxin is produced in the intestines of the African black mamba. The protein contains ten cysteines that oxidize to form five disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


AVITGACERDLQCGKGTCCAVSLWIKSVRVCTPVGTSGEDCHPASHKIPFSGQRMHHTCPCAPNLACVQTSPKKFKCLSK

Top groups


  1. Avatar for Anthropic Dreams 100 pts. 10,297
  2. Avatar for Beta Folders 2. Beta Folders 77 pts. 10,248
  3. Avatar for Contenders 3. Contenders 58 pts. 10,221
  4. Avatar for Gargleblasters 4. Gargleblasters 43 pts. 10,204
  5. Avatar for Go Science 5. Go Science 31 pts. 10,186
  6. Avatar for Void Crushers 6. Void Crushers 22 pts. 10,152
  7. Avatar for L'Alliance Francophone 7. L'Alliance Francophone 15 pts. 10,151
  8. Avatar for Marvin's bunch 8. Marvin's bunch 11 pts. 10,090
  9. Avatar for HMT heritage 9. HMT heritage 7 pts. 10,050
  10. Avatar for Italiani Al Lavoro 10. Italiani Al Lavoro 5 pts. 9,924

  1. Avatar for Galaxie
    1. Galaxie Lv 1
    100 pts. 10,295
  2. Avatar for markm457 2. markm457 Lv 1 97 pts. 10,264
  3. Avatar for eusair 3. eusair Lv 1 94 pts. 10,229
  4. Avatar for retiredmichael 4. retiredmichael Lv 1 92 pts. 10,228
  5. Avatar for mimi 5. mimi Lv 1 89 pts. 10,212
  6. Avatar for bertro 6. bertro Lv 1 86 pts. 10,207
  7. Avatar for LociOiling 7. LociOiling Lv 1 83 pts. 10,206
  8. Avatar for actiasluna 8. actiasluna Lv 1 81 pts. 10,201
  9. Avatar for randomlil 9. randomlil Lv 1 78 pts. 10,179
  10. Avatar for gmn 10. gmn Lv 1 76 pts. 10,171

Comments