Placeholder image of a protein
Icon representing a puzzle

1388: Revisiting Puzzle 114: Black Mamba

Closed since almost 9 years ago

Intermediate Overall Prediction

Summary

Created
June 07, 2017
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This toxin is produced in the intestines of the African black mamba. The protein contains ten cysteines that oxidize to form five disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


AVITGACERDLQCGKGTCCAVSLWIKSVRVCTPVGTSGEDCHPASHKIPFSGQRMHHTCPCAPNLACVQTSPKKFKCLSK

Top groups

  1. Avatar for Russian team 11. Russian team 3 pts. 9,848
  2. Avatar for Natural Abilities 12. Natural Abilities 2 pts. 9,829
  3. Avatar for Richard Dawkins Foundation 13. Richard Dawkins Foundation 1 pt. 9,510
  4. Avatar for xkcd 14. xkcd 1 pt. 9,284
  5. Avatar for Piratenpartei Deutschland 15. Piratenpartei Deutschland 1 pt. 9,021
  6. Avatar for freefolder 16. freefolder 1 pt. 8,724
  7. Avatar for FoldIt@Netherlands 17. FoldIt@Netherlands 1 pt. 8,602
  8. Avatar for GUGITBIOTECH 18. GUGITBIOTECH 1 pt. 8,598
  9. Avatar for UWO CHEM365 S2017 19. UWO CHEM365 S2017 1 pt. 7,949
  10. Avatar for Team South Africa 20. Team South Africa 1 pt. 6,902
  1. Avatar for Bruno Kestemont 21. Bruno Kestemont Lv 1 52 pts. 10,131
  2. Avatar for joremen 22. joremen Lv 1 50 pts. 10,125
  3. Avatar for anthion 23. anthion Lv 1 49 pts. 10,125
  4. Avatar for Aubade01 24. Aubade01 Lv 1 47 pts. 10,124
  5. Avatar for crpainter 25. crpainter Lv 1 45 pts. 10,124
  6. Avatar for gitwut 26. gitwut Lv 1 44 pts. 10,114
  7. Avatar for toshiue 27. toshiue Lv 1 42 pts. 10,114
  8. Avatar for tokens 28. tokens Lv 1 41 pts. 10,097
  9. Avatar for frood66 29. frood66 Lv 1 39 pts. 10,090
  10. Avatar for Bletchley Park 30. Bletchley Park Lv 1 38 pts. 10,089

Comments