Placeholder image of a protein
Icon representing a puzzle

1388: Revisiting Puzzle 114: Black Mamba

Closed since almost 9 years ago

Intermediate Overall Prediction

Summary

Created
June 07, 2017
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This toxin is produced in the intestines of the African black mamba. The protein contains ten cysteines that oxidize to form five disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


AVITGACERDLQCGKGTCCAVSLWIKSVRVCTPVGTSGEDCHPASHKIPFSGQRMHHTCPCAPNLACVQTSPKKFKCLSK

Top groups

  1. Avatar for Anthropic Dreams
    1. Anthropic Dreams
    100 pts. 10,297
  2. Avatar for Beta Folders 2. Beta Folders 77 pts. 10,248
  3. Avatar for Contenders 3. Contenders 58 pts. 10,221
  4. Avatar for Gargleblasters 4. Gargleblasters 43 pts. 10,204
  5. Avatar for Go Science 5. Go Science 31 pts. 10,186
  6. Avatar for Void Crushers 6. Void Crushers 22 pts. 10,152
  7. Avatar for L'Alliance Francophone 7. L'Alliance Francophone 15 pts. 10,151
  8. Avatar for Marvin's bunch 8. Marvin's bunch 11 pts. 10,090
  9. Avatar for HMT heritage 9. HMT heritage 7 pts. 10,050
  10. Avatar for Italiani Al Lavoro 10. Italiani Al Lavoro 5 pts. 9,924
  1. Avatar for eromana 11. eromana Lv 1 9 pts. 10,204
  2. Avatar for smholst 12. smholst Lv 1 7 pts. 10,200
  3. Avatar for retiredmichael 13. retiredmichael Lv 1 5 pts. 10,189
  4. Avatar for Bruno Kestemont 14. Bruno Kestemont Lv 1 4 pts. 10,186
  5. Avatar for toshiue 15. toshiue Lv 1 3 pts. 10,183
  6. Avatar for mimi 16. mimi Lv 1 2 pts. 10,180
  7. Avatar for lamoille 17. lamoille Lv 1 1 pt. 10,165
  8. Avatar for georg137 18. georg137 Lv 1 1 pt. 10,143
  9. Avatar for Hollinas 19. Hollinas Lv 1 1 pt. 10,131
  10. Avatar for Blipperman 20. Blipperman Lv 1 1 pt. 10,121

Comments