Placeholder image of a protein
Icon representing a puzzle

1388: Revisiting Puzzle 114: Black Mamba

Closed since almost 9 years ago

Intermediate Overall Prediction

Summary


Created
June 07, 2017
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This toxin is produced in the intestines of the African black mamba. The protein contains ten cysteines that oxidize to form five disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


AVITGACERDLQCGKGTCCAVSLWIKSVRVCTPVGTSGEDCHPASHKIPFSGQRMHHTCPCAPNLACVQTSPKKFKCLSK

Top groups


  1. Avatar for Anthropic Dreams 100 pts. 10,297
  2. Avatar for Beta Folders 2. Beta Folders 77 pts. 10,248
  3. Avatar for Contenders 3. Contenders 58 pts. 10,221
  4. Avatar for Gargleblasters 4. Gargleblasters 43 pts. 10,204
  5. Avatar for Go Science 5. Go Science 31 pts. 10,186
  6. Avatar for Void Crushers 6. Void Crushers 22 pts. 10,152
  7. Avatar for L'Alliance Francophone 7. L'Alliance Francophone 15 pts. 10,151
  8. Avatar for Marvin's bunch 8. Marvin's bunch 11 pts. 10,090
  9. Avatar for HMT heritage 9. HMT heritage 7 pts. 10,050
  10. Avatar for Italiani Al Lavoro 10. Italiani Al Lavoro 5 pts. 9,924

  1. Avatar for Bruno Kestemont 21. Bruno Kestemont Lv 1 52 pts. 10,131
  2. Avatar for joremen 22. joremen Lv 1 50 pts. 10,125
  3. Avatar for anthion 23. anthion Lv 1 49 pts. 10,125
  4. Avatar for Aubade01 24. Aubade01 Lv 1 47 pts. 10,124
  5. Avatar for crpainter 25. crpainter Lv 1 45 pts. 10,124
  6. Avatar for gitwut 26. gitwut Lv 1 44 pts. 10,114
  7. Avatar for toshiue 27. toshiue Lv 1 42 pts. 10,114
  8. Avatar for tokens 28. tokens Lv 1 41 pts. 10,097
  9. Avatar for frood66 29. frood66 Lv 1 39 pts. 10,090
  10. Avatar for Bletchley Park 30. Bletchley Park Lv 1 38 pts. 10,089

Comments