Placeholder image of a protein
Icon representing a puzzle

1388: Revisiting Puzzle 114: Black Mamba

Closed since almost 9 years ago

Intermediate Overall Prediction

Summary


Created
June 07, 2017
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This toxin is produced in the intestines of the African black mamba. The protein contains ten cysteines that oxidize to form five disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


AVITGACERDLQCGKGTCCAVSLWIKSVRVCTPVGTSGEDCHPASHKIPFSGQRMHHTCPCAPNLACVQTSPKKFKCLSK

Top groups


  1. Avatar for Anthropic Dreams 100 pts. 10,297
  2. Avatar for Beta Folders 2. Beta Folders 77 pts. 10,248
  3. Avatar for Contenders 3. Contenders 58 pts. 10,221
  4. Avatar for Gargleblasters 4. Gargleblasters 43 pts. 10,204
  5. Avatar for Go Science 5. Go Science 31 pts. 10,186
  6. Avatar for Void Crushers 6. Void Crushers 22 pts. 10,152
  7. Avatar for L'Alliance Francophone 7. L'Alliance Francophone 15 pts. 10,151
  8. Avatar for Marvin's bunch 8. Marvin's bunch 11 pts. 10,090
  9. Avatar for HMT heritage 9. HMT heritage 7 pts. 10,050
  10. Avatar for Italiani Al Lavoro 10. Italiani Al Lavoro 5 pts. 9,924

  1. Avatar for caglar 31. caglar Lv 1 36 pts. 10,082
  2. Avatar for stomjoh 32. stomjoh Lv 1 35 pts. 10,081
  3. Avatar for smilingone 33. smilingone Lv 1 34 pts. 10,055
  4. Avatar for altejoh 34. altejoh Lv 1 33 pts. 10,055
  5. Avatar for YeshuaLives 35. YeshuaLives Lv 1 31 pts. 10,052
  6. Avatar for O Seki To 36. O Seki To Lv 1 30 pts. 10,050
  7. Avatar for guineapig 37. guineapig Lv 1 29 pts. 10,048
  8. Avatar for Museka 38. Museka Lv 1 28 pts. 10,044
  9. Avatar for MicElephant 39. MicElephant Lv 1 27 pts. 10,042
  10. Avatar for katling 40. katling Lv 1 26 pts. 10,041

Comments