Placeholder image of a protein
Icon representing a puzzle

1388: Revisiting Puzzle 114: Black Mamba

Closed since almost 9 years ago

Intermediate Intermediate Overall Overall Prediction Prediction

Summary


Created
June 07, 2017
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This toxin is produced in the intestines of the African black mamba. The protein contains ten cysteines that oxidize to form five disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


AVITGACERDLQCGKGTCCAVSLWIKSVRVCTPVGTSGEDCHPASHKIPFSGQRMHHTCPCAPNLACVQTSPKKFKCLSK

Top groups


  1. Avatar for Anthropic Dreams 100 pts. 10,297
  2. Avatar for Beta Folders 2. Beta Folders 77 pts. 10,248
  3. Avatar for Contenders 3. Contenders 58 pts. 10,221
  4. Avatar for Gargleblasters 4. Gargleblasters 43 pts. 10,204
  5. Avatar for Go Science 5. Go Science 31 pts. 10,186
  6. Avatar for Void Crushers 6. Void Crushers 22 pts. 10,152
  7. Avatar for L'Alliance Francophone 7. L'Alliance Francophone 15 pts. 10,151
  8. Avatar for Marvin's bunch 8. Marvin's bunch 11 pts. 10,090
  9. Avatar for HMT heritage 9. HMT heritage 7 pts. 10,050
  10. Avatar for Italiani Al Lavoro 10. Italiani Al Lavoro 5 pts. 9,924

  1. Avatar for diamonddays 41. diamonddays Lv 1 25 pts. 10,036
  2. Avatar for pvc78 42. pvc78 Lv 1 24 pts. 10,018
  3. Avatar for NinjaGreg 43. NinjaGreg Lv 1 23 pts. 10,012
  4. Avatar for Flagg65a 44. Flagg65a Lv 1 22 pts. 10,008
  5. Avatar for WBarme1234 45. WBarme1234 Lv 1 21 pts. 10,000
  6. Avatar for Norrjane 46. Norrjane Lv 1 20 pts. 9,995
  7. Avatar for Vinara 47. Vinara Lv 1 19 pts. 9,985
  8. Avatar for Glen B 48. Glen B Lv 1 19 pts. 9,972
  9. Avatar for ZeroLeak7 49. ZeroLeak7 Lv 1 18 pts. 9,968
  10. Avatar for hansvandenhof 50. hansvandenhof Lv 1 17 pts. 9,960

Comments