Placeholder image of a protein
Icon representing a puzzle

1388: Revisiting Puzzle 114: Black Mamba

Closed since almost 9 years ago

Intermediate Intermediate Overall Overall Prediction Prediction

Summary


Created
June 07, 2017
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This toxin is produced in the intestines of the African black mamba. The protein contains ten cysteines that oxidize to form five disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


AVITGACERDLQCGKGTCCAVSLWIKSVRVCTPVGTSGEDCHPASHKIPFSGQRMHHTCPCAPNLACVQTSPKKFKCLSK

Top groups


  1. Avatar for Anthropic Dreams 100 pts. 10,297
  2. Avatar for Beta Folders 2. Beta Folders 77 pts. 10,248
  3. Avatar for Contenders 3. Contenders 58 pts. 10,221
  4. Avatar for Gargleblasters 4. Gargleblasters 43 pts. 10,204
  5. Avatar for Go Science 5. Go Science 31 pts. 10,186
  6. Avatar for Void Crushers 6. Void Crushers 22 pts. 10,152
  7. Avatar for L'Alliance Francophone 7. L'Alliance Francophone 15 pts. 10,151
  8. Avatar for Marvin's bunch 8. Marvin's bunch 11 pts. 10,090
  9. Avatar for HMT heritage 9. HMT heritage 7 pts. 10,050
  10. Avatar for Italiani Al Lavoro 10. Italiani Al Lavoro 5 pts. 9,924

  1. Avatar for Anfinsen_slept_here 51. Anfinsen_slept_here Lv 1 16 pts. 9,935
  2. Avatar for alwen 52. alwen Lv 1 16 pts. 9,934
  3. Avatar for Mydogisa Toelicker 53. Mydogisa Toelicker Lv 1 15 pts. 9,924
  4. Avatar for deLaCeiba 54. deLaCeiba Lv 1 14 pts. 9,924
  5. Avatar for Bobnine 55. Bobnine Lv 1 14 pts. 9,920
  6. Avatar for isaksson 56. isaksson Lv 1 13 pts. 9,918
  7. Avatar for tarimo 57. tarimo Lv 1 12 pts. 9,914
  8. Avatar for jobo0502 58. jobo0502 Lv 1 12 pts. 9,899
  9. Avatar for ViJay7019 59. ViJay7019 Lv 1 11 pts. 9,899
  10. Avatar for bcre8tvv 60. bcre8tvv Lv 1 11 pts. 9,885

Comments