Placeholder image of a protein
Icon representing a puzzle

1388: Revisiting Puzzle 114: Black Mamba

Closed since almost 9 years ago

Intermediate Intermediate Overall Overall Prediction Prediction

Summary


Created
June 07, 2017
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This toxin is produced in the intestines of the African black mamba. The protein contains ten cysteines that oxidize to form five disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


AVITGACERDLQCGKGTCCAVSLWIKSVRVCTPVGTSGEDCHPASHKIPFSGQRMHHTCPCAPNLACVQTSPKKFKCLSK

Top groups


  1. Avatar for Anthropic Dreams 100 pts. 10,297
  2. Avatar for Beta Folders 2. Beta Folders 77 pts. 10,248
  3. Avatar for Contenders 3. Contenders 58 pts. 10,221
  4. Avatar for Gargleblasters 4. Gargleblasters 43 pts. 10,204
  5. Avatar for Go Science 5. Go Science 31 pts. 10,186
  6. Avatar for Void Crushers 6. Void Crushers 22 pts. 10,152
  7. Avatar for L'Alliance Francophone 7. L'Alliance Francophone 15 pts. 10,151
  8. Avatar for Marvin's bunch 8. Marvin's bunch 11 pts. 10,090
  9. Avatar for HMT heritage 9. HMT heritage 7 pts. 10,050
  10. Avatar for Italiani Al Lavoro 10. Italiani Al Lavoro 5 pts. 9,924

  1. Avatar for alcor29 71. alcor29 Lv 1 6 pts. 9,743
  2. Avatar for tomespen 72. tomespen Lv 1 6 pts. 9,734
  3. Avatar for Deleted player 73. Deleted player pts. 9,722
  4. Avatar for ManVsYard 74. ManVsYard Lv 1 6 pts. 9,707
  5. Avatar for cobaltteal 75. cobaltteal Lv 1 5 pts. 9,690
  6. Avatar for dbuske 76. dbuske Lv 1 5 pts. 9,674
  7. Avatar for froggs554 77. froggs554 Lv 1 5 pts. 9,643
  8. Avatar for uihcv 78. uihcv Lv 1 4 pts. 9,603
  9. Avatar for spritz1992 79. spritz1992 Lv 1 4 pts. 9,581
  10. Avatar for dssb 80. dssb Lv 1 4 pts. 9,576

Comments