1388: Revisiting Puzzle 114: Black Mamba

Closed since almost 9 years ago

Summary

• Created: June 07, 2017
• Expires: June 15, 2017 at 18:00 UTC
• Max points: 100

Description

This is a throwback puzzle to the early days of Foldit. This toxin is produced in the intestines of the African black mamba. The protein contains ten cysteines that oxidize to form five disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:

AVITGACERDLQCGKGTCCAVSLWIKSVRVCTPVGTSGEDCHPASHKIPFSGQRMHHTCPCAPNLACVQTSPKKFKCLSK

Top groups

• 1. Anthropic Dreams 100 pts. 10,297
• 2. Beta Folders 77 pts. 10,248
• 3. Contenders 58 pts. 10,221
• 4. Gargleblasters 43 pts. 10,204
• 5. Go Science 31 pts. 10,186
• 6. Void Crushers 22 pts. 10,152
• 7. L'Alliance Francophone 15 pts. 10,151
• 8. Marvin's bunch 11 pts. 10,090
• 9. HMT heritage 7 pts. 10,050
• 10. Italiani Al Lavoro 5 pts. 9,924

Top soloists

• 11. dcrwheeler 73 pts. 10,162
• 12. Timo van der Laan 71 pts. 10,152
• 13. nicobul 69 pts. 10,151
• 14. reefyrob 66 pts. 10,150
• 15. kabubi 64 pts. 10,149
• 16. fiendish_ghoul 62 pts. 10,148
• 17. christioanchauvin 60 pts. 10,147
• 18. SaraL 58 pts. 10,140
• 19. johnmitch 56 pts. 10,136
• 20. georg137 54 pts. 10,133