Placeholder image of a protein
Icon representing a puzzle

1390: Dysferlin Linker Domain: Rosetta Model

Closed since over 8 years ago

Intermediate Overall Prediction Predicted Contacts

Summary


Created
June 13, 2017
Expires
Max points
100
Description

This is a follow-up puzzle for Puzzles 1369 and 1372. Here we've provided the top Rosetta prediction as the starting structure. Note that predicted contacts are still available, and can be accessed from the Main menu (Selection Interface) or in the Actions tab (Classic Interface). Players may load in manual saves from Puzzles 1369 and 1372 and use them as a starting point here.



This is a domain of the human dysferlin protein. Dysferlin is found in muscle cells and associates with the cell membrane, although its exact function is unknown. Mutations in the dysferlin gene can cause a debilitating type of muscular dystrophy. See the blog for more info. Our collaborators at the Jain Foundation would like to model the structure of dysferlin to better understand its function, and have asked Foldit players to help! Players may recall folding the C2B calcium-binding domain of dysferlin in Puzzles 1291 and 1293b. The residues modeled in this puzzle link two calcium-binding domains in dysferlin. It is unclear whether this domain serves a particular function, but some experimental data suggests it is well-folded.



Sequence:


PQTYCVSGPNQWRDQLRPSQLLHLFCQQHRVKAPVYRTDRVMFQDKEYSIEEIEAGRIPNPHLGPVEERLALHVLQQQGLVPEHVESRPLYSPLQPDIE

Top groups


  1. Avatar for Anthropic Dreams 100 pts. 11,270
  2. Avatar for Beta Folders 2. Beta Folders 70 pts. 11,248
  3. Avatar for Go Science 3. Go Science 47 pts. 10,978
  4. Avatar for Void Crushers 4. Void Crushers 30 pts. 10,943
  5. Avatar for Contenders 5. Contenders 19 pts. 10,914
  6. Avatar for Gargleblasters 6. Gargleblasters 11 pts. 10,906
  7. Avatar for L'Alliance Francophone 7. L'Alliance Francophone 7 pts. 10,577
  8. Avatar for Marvin's bunch 8. Marvin's bunch 4 pts. 10,560
  9. Avatar for Natural Abilities 9. Natural Abilities 2 pts. 10,504

  1. Avatar for tomespen 51. tomespen Lv 1 15 pts. 10,545
  2. Avatar for smholst 52. smholst Lv 1 14 pts. 10,540
  3. Avatar for johngran 53. johngran Lv 1 13 pts. 10,530
  4. Avatar for drjr 54. drjr Lv 1 13 pts. 10,527
  5. Avatar for anthion 55. anthion Lv 1 12 pts. 10,526
  6. Avatar for Norrjane 56. Norrjane Lv 1 12 pts. 10,526
  7. Avatar for christioanchauvin 57. christioanchauvin Lv 1 11 pts. 10,519
  8. Avatar for dcrwheeler 58. dcrwheeler Lv 1 11 pts. 10,517
  9. Avatar for froggs554 59. froggs554 Lv 1 10 pts. 10,508
  10. Avatar for weitzen 60. weitzen Lv 1 10 pts. 10,507

Comments