Placeholder image of a protein
Icon representing a puzzle

1390: Dysferlin Linker Domain: Rosetta Model

Closed since over 8 years ago

Intermediate Overall Prediction Predicted Contacts

Summary


Created
June 13, 2017
Expires
Max points
100
Description

This is a follow-up puzzle for Puzzles 1369 and 1372. Here we've provided the top Rosetta prediction as the starting structure. Note that predicted contacts are still available, and can be accessed from the Main menu (Selection Interface) or in the Actions tab (Classic Interface). Players may load in manual saves from Puzzles 1369 and 1372 and use them as a starting point here.



This is a domain of the human dysferlin protein. Dysferlin is found in muscle cells and associates with the cell membrane, although its exact function is unknown. Mutations in the dysferlin gene can cause a debilitating type of muscular dystrophy. See the blog for more info. Our collaborators at the Jain Foundation would like to model the structure of dysferlin to better understand its function, and have asked Foldit players to help! Players may recall folding the C2B calcium-binding domain of dysferlin in Puzzles 1291 and 1293b. The residues modeled in this puzzle link two calcium-binding domains in dysferlin. It is unclear whether this domain serves a particular function, but some experimental data suggests it is well-folded.



Sequence:


PQTYCVSGPNQWRDQLRPSQLLHLFCQQHRVKAPVYRTDRVMFQDKEYSIEEIEAGRIPNPHLGPVEERLALHVLQQQGLVPEHVESRPLYSPLQPDIE

Top groups


  1. Avatar for Anthropic Dreams 100 pts. 11,270
  2. Avatar for Beta Folders 2. Beta Folders 70 pts. 11,248
  3. Avatar for Go Science 3. Go Science 47 pts. 10,978
  4. Avatar for Void Crushers 4. Void Crushers 30 pts. 10,943
  5. Avatar for Contenders 5. Contenders 19 pts. 10,914
  6. Avatar for Gargleblasters 6. Gargleblasters 11 pts. 10,906
  7. Avatar for L'Alliance Francophone 7. L'Alliance Francophone 7 pts. 10,577
  8. Avatar for Marvin's bunch 8. Marvin's bunch 4 pts. 10,560
  9. Avatar for Natural Abilities 9. Natural Abilities 2 pts. 10,504

  1. Avatar for diamonddays 71. diamonddays Lv 1 5 pts. 10,455
  2. Avatar for alwen 72. alwen Lv 1 5 pts. 10,455
  3. Avatar for Fog Darts 73. Fog Darts Lv 1 5 pts. 10,449
  4. Avatar for harvardman 74. harvardman Lv 1 5 pts. 10,446
  5. Avatar for pvc78 75. pvc78 Lv 1 4 pts. 10,443
  6. Avatar for Alistair69 76. Alistair69 Lv 1 4 pts. 10,440
  7. Avatar for NinjaGreg 77. NinjaGreg Lv 1 4 pts. 10,435
  8. Avatar for mitarcher 78. mitarcher Lv 1 4 pts. 10,433
  9. Avatar for Flagg65a 79. Flagg65a Lv 1 4 pts. 10,431
  10. Avatar for Mike Cassidy 80. Mike Cassidy Lv 1 3 pts. 10,427

Comments