Placeholder image of a protein
Icon representing a puzzle

1391: Revisiting Puzzle 115: Exocyst

Closed since almost 9 years ago

Intermediate Overall Prediction

Summary


Created
June 15, 2017
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein is involved in the process of exocytosis, transporting proteins to the cell membrane or extracellular areas. The protein is modeled here in reduced form, so no disulfides are expected to form. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


HMRQPPLVTGISPNEGIPWTKVTIRGENLGTGPTDLIGLTICGHNCLLTAEWMSASKIVCRVGQAKNDKGDIIVTTKSGGKGTSTVSFKLLKPEK

Top groups


  1. Avatar for xkcd 12. xkcd 1 pt. 8,982
  2. Avatar for Natural Abilities 13. Natural Abilities 1 pt. 8,982
  3. Avatar for IEGS Biochemistry 14. IEGS Biochemistry 1 pt. 8,605
  4. Avatar for GUGITBIOTECH 15. GUGITBIOTECH 1 pt. 7,913
  5. Avatar for Window Group 16. Window Group 1 pt. 6,662

  1. Avatar for lange 121. lange Lv 1 1 pt. 8,637
  2. Avatar for rinze 122. rinze Lv 1 1 pt. 8,630
  3. Avatar for trentis1 123. trentis1 Lv 1 1 pt. 8,609
  4. Avatar for 1000kr 124. 1000kr Lv 1 1 pt. 8,605
  5. Avatar for DScott 125. DScott Lv 1 1 pt. 8,587
  6. Avatar for sammiibee16 126. sammiibee16 Lv 1 1 pt. 8,585
  7. Avatar for gabrielamontaldi18 127. gabrielamontaldi18 Lv 1 1 pt. 8,584
  8. Avatar for groudit 128. groudit Lv 1 1 pt. 8,573
  9. Avatar for goliat1971 129. goliat1971 Lv 1 1 pt. 8,542
  10. Avatar for utan 130. utan Lv 1 1 pt. 8,525

Comments