Placeholder image of a protein
Icon representing a puzzle

1391: Revisiting Puzzle 115: Exocyst

Closed since almost 9 years ago

Intermediate Overall Prediction

Summary

Created
June 15, 2017
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein is involved in the process of exocytosis, transporting proteins to the cell membrane or extracellular areas. The protein is modeled here in reduced form, so no disulfides are expected to form. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


HMRQPPLVTGISPNEGIPWTKVTIRGENLGTGPTDLIGLTICGHNCLLTAEWMSASKIVCRVGQAKNDKGDIIVTTKSGGKGTSTVSFKLLKPEK

Top groups

  1. Avatar for Richard Dawkins Foundation 11. Richard Dawkins Foundation 1 pt. 9,051
  2. Avatar for xkcd 12. xkcd 1 pt. 8,982
  3. Avatar for Natural Abilities 13. Natural Abilities 1 pt. 8,982
  4. Avatar for IEGS Biochemistry 14. IEGS Biochemistry 1 pt. 8,605
  5. Avatar for GUGITBIOTECH 15. GUGITBIOTECH 1 pt. 7,913
  6. Avatar for Window Group 16. Window Group 1 pt. 6,662
  1. Avatar for 3.14mathgeek 131. 3.14mathgeek Lv 1 1 pt. 8,524
  2. Avatar for a791412276 132. a791412276 Lv 1 1 pt. 8,509
  3. Avatar for Husain.Sarah 133. Husain.Sarah Lv 1 1 pt. 8,480
  4. Avatar for gu14003 134. gu14003 Lv 1 1 pt. 7,913
  5. Avatar for jbmkfm125 135. jbmkfm125 Lv 1 1 pt. 7,858
  6. Avatar for 01010011111 136. 01010011111 Lv 1 1 pt. 7,660
  7. Avatar for robkleffner 137. robkleffner Lv 1 1 pt. 7,348
  8. Avatar for Uttkarsh 138. Uttkarsh Lv 1 1 pt. 6,662
  9. Avatar for eromana 139. eromana Lv 1 1 pt. 6,662
  10. Avatar for Hollinas 140. Hollinas Lv 1 1 pt. 6,662

Comments