Placeholder image of a protein
Icon representing a puzzle

1391: Revisiting Puzzle 115: Exocyst

Closed since almost 9 years ago

Intermediate Overall Prediction

Summary

Created
June 15, 2017
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein is involved in the process of exocytosis, transporting proteins to the cell membrane or extracellular areas. The protein is modeled here in reduced form, so no disulfides are expected to form. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


HMRQPPLVTGISPNEGIPWTKVTIRGENLGTGPTDLIGLTICGHNCLLTAEWMSASKIVCRVGQAKNDKGDIIVTTKSGGKGTSTVSFKLLKPEK

Top groups

  1. Avatar for Richard Dawkins Foundation 11. Richard Dawkins Foundation 1 pt. 9,051
  2. Avatar for xkcd 12. xkcd 1 pt. 8,982
  3. Avatar for Natural Abilities 13. Natural Abilities 1 pt. 8,982
  4. Avatar for IEGS Biochemistry 14. IEGS Biochemistry 1 pt. 8,605
  5. Avatar for GUGITBIOTECH 15. GUGITBIOTECH 1 pt. 7,913
  6. Avatar for Window Group 16. Window Group 1 pt. 6,662
  1. Avatar for Scopper 141. Scopper Lv 1 1 pt. 6,662
  2. Avatar for jflat06 142. jflat06 Lv 1 1 pt. 6,662
  3. Avatar for Skippysk8s 143. Skippysk8s Lv 1 1 pt. 6,662

Comments