Placeholder image of a protein
Icon representing a puzzle

1391: Revisiting Puzzle 115: Exocyst

Closed since over 8 years ago

Intermediate Overall Prediction

Summary

Created
June 15, 2017
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein is involved in the process of exocytosis, transporting proteins to the cell membrane or extracellular areas. The protein is modeled here in reduced form, so no disulfides are expected to form. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


HMRQPPLVTGISPNEGIPWTKVTIRGENLGTGPTDLIGLTICGHNCLLTAEWMSASKIVCRVGQAKNDKGDIIVTTKSGGKGTSTVSFKLLKPEK

Top groups

  1. Avatar for Richard Dawkins Foundation 11. Richard Dawkins Foundation 1 pt. 9,051
  2. Avatar for xkcd 12. xkcd 1 pt. 8,982
  3. Avatar for Natural Abilities 13. Natural Abilities 1 pt. 8,982
  4. Avatar for IEGS Biochemistry 14. IEGS Biochemistry 1 pt. 8,605
  5. Avatar for GUGITBIOTECH 15. GUGITBIOTECH 1 pt. 7,913
  6. Avatar for Window Group 16. Window Group 1 pt. 6,662
  1. Avatar for eusair 11. eusair Lv 1 70 pts. 9,565
  2. Avatar for tomespen 12. tomespen Lv 1 67 pts. 9,557
  3. Avatar for reefyrob 13. reefyrob Lv 1 65 pts. 9,554
  4. Avatar for retiredmichael 14. retiredmichael Lv 1 62 pts. 9,551
  5. Avatar for kamilko 15. kamilko Lv 1 60 pts. 9,547
  6. Avatar for jermainiac 16. jermainiac Lv 1 58 pts. 9,544
  7. Avatar for gitwut 17. gitwut Lv 1 56 pts. 9,532
  8. Avatar for fiendish_ghoul 18. fiendish_ghoul Lv 1 53 pts. 9,531
  9. Avatar for randomlil 19. randomlil Lv 1 51 pts. 9,516
  10. Avatar for Galaxie 20. Galaxie Lv 1 49 pts. 9,506

Comments