Placeholder image of a protein
Icon representing a puzzle

1391: Revisiting Puzzle 115: Exocyst

Closed since almost 9 years ago

Intermediate Overall Prediction

Summary


Created
June 15, 2017
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein is involved in the process of exocytosis, transporting proteins to the cell membrane or extracellular areas. The protein is modeled here in reduced form, so no disulfides are expected to form. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


HMRQPPLVTGISPNEGIPWTKVTIRGENLGTGPTDLIGLTICGHNCLLTAEWMSASKIVCRVGQAKNDKGDIIVTTKSGGKGTSTVSFKLLKPEK

Top groups


  1. Avatar for xkcd 12. xkcd 1 pt. 8,982
  2. Avatar for Natural Abilities 13. Natural Abilities 1 pt. 8,982
  3. Avatar for IEGS Biochemistry 14. IEGS Biochemistry 1 pt. 8,605
  4. Avatar for GUGITBIOTECH 15. GUGITBIOTECH 1 pt. 7,913
  5. Avatar for Window Group 16. Window Group 1 pt. 6,662

  1. Avatar for NinjaGreg 21. NinjaGreg Lv 1 47 pts. 9,505
  2. Avatar for tokens 22. tokens Lv 1 45 pts. 9,494
  3. Avatar for smilingone 23. smilingone Lv 1 44 pts. 9,479
  4. Avatar for georg137 24. georg137 Lv 1 42 pts. 9,464
  5. Avatar for nicobul 25. nicobul Lv 1 40 pts. 9,456
  6. Avatar for kabubi 26. kabubi Lv 1 38 pts. 9,447
  7. Avatar for mimi 27. mimi Lv 1 37 pts. 9,446
  8. Avatar for carsonfb 28. carsonfb Lv 1 35 pts. 9,442
  9. Avatar for christioanchauvin 29. christioanchauvin Lv 1 34 pts. 9,424
  10. Avatar for Jim Fraser 30. Jim Fraser Lv 1 32 pts. 9,419

Comments