Placeholder image of a protein
Icon representing a puzzle

1391: Revisiting Puzzle 115: Exocyst

Closed since almost 9 years ago

Intermediate Overall Prediction

Summary

Created
June 15, 2017
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein is involved in the process of exocytosis, transporting proteins to the cell membrane or extracellular areas. The protein is modeled here in reduced form, so no disulfides are expected to form. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


HMRQPPLVTGISPNEGIPWTKVTIRGENLGTGPTDLIGLTICGHNCLLTAEWMSASKIVCRVGQAKNDKGDIIVTTKSGGKGTSTVSFKLLKPEK

Top groups

  1. Avatar for Richard Dawkins Foundation 11. Richard Dawkins Foundation 1 pt. 9,051
  2. Avatar for xkcd 12. xkcd 1 pt. 8,982
  3. Avatar for Natural Abilities 13. Natural Abilities 1 pt. 8,982
  4. Avatar for IEGS Biochemistry 14. IEGS Biochemistry 1 pt. 8,605
  5. Avatar for GUGITBIOTECH 15. GUGITBIOTECH 1 pt. 7,913
  6. Avatar for Window Group 16. Window Group 1 pt. 6,662
  1. Avatar for dssb 41. dssb Lv 1 20 pts. 9,324
  2. Avatar for katling 42. katling Lv 1 19 pts. 9,321
  3. Avatar for Anfinsen_slept_here 43. Anfinsen_slept_here Lv 1 18 pts. 9,317
  4. Avatar for weitzen 44. weitzen Lv 1 17 pts. 9,316
  5. Avatar for deLaCeiba 45. deLaCeiba Lv 1 16 pts. 9,290
  6. Avatar for jausmh 46. jausmh Lv 1 15 pts. 9,290
  7. Avatar for jobo0502 47. jobo0502 Lv 1 15 pts. 9,286
  8. Avatar for Threeoak 48. Threeoak Lv 1 14 pts. 9,284
  9. Avatar for caglar 49. caglar Lv 1 13 pts. 9,281
  10. Avatar for WBarme1234 50. WBarme1234 Lv 1 13 pts. 9,272

Comments