Placeholder image of a protein
Icon representing a puzzle

1391: Revisiting Puzzle 115: Exocyst

Closed since almost 9 years ago

Intermediate Overall Prediction

Summary

Created
June 15, 2017
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein is involved in the process of exocytosis, transporting proteins to the cell membrane or extracellular areas. The protein is modeled here in reduced form, so no disulfides are expected to form. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


HMRQPPLVTGISPNEGIPWTKVTIRGENLGTGPTDLIGLTICGHNCLLTAEWMSASKIVCRVGQAKNDKGDIIVTTKSGGKGTSTVSFKLLKPEK

Top groups

  1. Avatar for Richard Dawkins Foundation 11. Richard Dawkins Foundation 1 pt. 9,051
  2. Avatar for xkcd 12. xkcd 1 pt. 8,982
  3. Avatar for Natural Abilities 13. Natural Abilities 1 pt. 8,982
  4. Avatar for IEGS Biochemistry 14. IEGS Biochemistry 1 pt. 8,605
  5. Avatar for GUGITBIOTECH 15. GUGITBIOTECH 1 pt. 7,913
  6. Avatar for Window Group 16. Window Group 1 pt. 6,662
  1. Avatar for Mydogisa Toelicker 81. Mydogisa Toelicker Lv 1 2 pts. 9,000
  2. Avatar for Qfast 82. Qfast Lv 1 2 pts. 9,000
  3. Avatar for roman madala 83. roman madala Lv 1 2 pts. 8,998
  4. Avatar for tarimo 84. tarimo Lv 1 2 pts. 8,992
  5. Avatar for boondog 85. boondog Lv 1 2 pts. 8,983
  6. Avatar for fryguy 86. fryguy Lv 1 2 pts. 8,982
  7. Avatar for Mr_Jolty 87. Mr_Jolty Lv 1 1 pt. 8,982
  8. Avatar for harvardman 88. harvardman Lv 1 1 pt. 8,957
  9. Avatar for drjr 89. drjr Lv 1 1 pt. 8,945
  10. Avatar for leehaggis 90. leehaggis Lv 1 1 pt. 8,944

Comments