Placeholder image of a protein
Icon representing a puzzle

1391: Revisiting Puzzle 115: Exocyst

Closed since over 8 years ago

Intermediate Overall Prediction

Summary


Created
June 15, 2017
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein is involved in the process of exocytosis, transporting proteins to the cell membrane or extracellular areas. The protein is modeled here in reduced form, so no disulfides are expected to form. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


HMRQPPLVTGISPNEGIPWTKVTIRGENLGTGPTDLIGLTICGHNCLLTAEWMSASKIVCRVGQAKNDKGDIIVTTKSGGKGTSTVSFKLLKPEK

Top groups


  1. Avatar for Gargleblasters 100 pts. 9,615
  2. Avatar for Anthropic Dreams 2. Anthropic Dreams 71 pts. 9,613
  3. Avatar for Void Crushers 3. Void Crushers 49 pts. 9,609
  4. Avatar for Go Science 4. Go Science 33 pts. 9,608
  5. Avatar for Beta Folders 5. Beta Folders 22 pts. 9,596
  6. Avatar for Contenders 6. Contenders 14 pts. 9,583
  7. Avatar for L'Alliance Francophone 7. L'Alliance Francophone 8 pts. 9,456
  8. Avatar for HMT heritage 8. HMT heritage 5 pts. 9,387
  9. Avatar for Marvin's bunch 9. Marvin's bunch 3 pts. 9,351
  10. Avatar for Italiani Al Lavoro 10. Italiani Al Lavoro 2 pts. 9,290

  1. Avatar for lastspirit 111. lastspirit Lv 1 1 pt. 8,724
  2. Avatar for NinguLilium 112. NinguLilium Lv 1 1 pt. 8,704
  3. Avatar for momadoc 113. momadoc Lv 1 1 pt. 8,703
  4. Avatar for cherry39 114. cherry39 Lv 1 1 pt. 8,700
  5. Avatar for Arne Heessels 115. Arne Heessels Lv 1 1 pt. 8,693
  6. Avatar for EvENinG_TtiMe 116. EvENinG_TtiMe Lv 1 1 pt. 8,677
  7. Avatar for sygel 117. sygel Lv 1 1 pt. 8,676
  8. Avatar for navn 118. navn Lv 1 1 pt. 8,669
  9. Avatar for MadCat08 119. MadCat08 Lv 1 1 pt. 8,658
  10. Avatar for awes0meb0y 120. awes0meb0y Lv 1 1 pt. 8,650

Comments