Placeholder image of a protein
Icon representing a puzzle

1391: Revisiting Puzzle 115: Exocyst

Closed since over 8 years ago

Intermediate Overall Prediction

Summary

Created
June 15, 2017
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein is involved in the process of exocytosis, transporting proteins to the cell membrane or extracellular areas. The protein is modeled here in reduced form, so no disulfides are expected to form. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


HMRQPPLVTGISPNEGIPWTKVTIRGENLGTGPTDLIGLTICGHNCLLTAEWMSASKIVCRVGQAKNDKGDIIVTTKSGGKGTSTVSFKLLKPEK

Top groups

  1. Avatar for Gargleblasters
    1. Gargleblasters
    100 pts. 9,615
  2. Avatar for Anthropic Dreams 2. Anthropic Dreams 71 pts. 9,613
  3. Avatar for Void Crushers 3. Void Crushers 49 pts. 9,609
  4. Avatar for Go Science 4. Go Science 33 pts. 9,608
  5. Avatar for Beta Folders 5. Beta Folders 22 pts. 9,596
  6. Avatar for Contenders 6. Contenders 14 pts. 9,583
  7. Avatar for L'Alliance Francophone 7. L'Alliance Francophone 8 pts. 9,456
  8. Avatar for HMT heritage 8. HMT heritage 5 pts. 9,387
  9. Avatar for Marvin's bunch 9. Marvin's bunch 3 pts. 9,351
  10. Avatar for Italiani Al Lavoro 10. Italiani Al Lavoro 2 pts. 9,290
  1. Avatar for AeonFluff 91. AeonFluff Lv 1 1 pt. 8,940
  2. Avatar for grogar7 92. grogar7 Lv 1 1 pt. 8,916
  3. Avatar for froggs554 93. froggs554 Lv 1 1 pt. 8,908
  4. Avatar for pandapharmd 94. pandapharmd Lv 1 1 pt. 8,897
  5. Avatar for Deleted player 95. Deleted player pts. 8,893
  6. Avatar for benrh 96. benrh Lv 1 1 pt. 8,878
  7. Avatar for spritz1992 97. spritz1992 Lv 1 1 pt. 8,872
  8. Avatar for martinf 98. martinf Lv 1 1 pt. 8,872
  9. Avatar for Museka 99. Museka Lv 1 1 pt. 8,869
  10. Avatar for emdee314 100. emdee314 Lv 1 1 pt. 8,860

Comments