Placeholder image of a protein
Icon representing a puzzle

1393: Unsolved De-novo Freestyle 107

Closed since almost 9 years ago

Intermediate Overall Prediction

Summary

Created
June 20, 2017
Expires
Max points
100
Description

The structure of this protein is still unknown. Secondary structure predictions (from PSIPRED) are marked on the starting structure, and provide clues about where the protein might form helices and sheets!



Sequence:


EKDEKIMEEMKKLVEQVKKKGGRVRITIRKENGTVRIRVEVDVDGHDTTVEWEGGSDDVMEHVKQQLQEVKDQHN

Top groups

  1. Avatar for Italiani Al Lavoro 11. Italiani Al Lavoro 2 pts. 9,041
  2. Avatar for Eὕρηκα! Heureka! 12. Eὕρηκα! Heureka! 1 pt. 8,590
  3. Avatar for Richard Dawkins Foundation 13. Richard Dawkins Foundation 1 pt. 8,453
  4. Avatar for DSN @ Home 14. DSN @ Home 1 pt. 7,841
  5. Avatar for Deleted group 15. Deleted group pts. 7,660
  6. Avatar for Team South Africa 16. Team South Africa 1 pt. 7,436
  7. Avatar for GUGITBIOTECH 17. GUGITBIOTECH 1 pt. 6,309
  8. Avatar for Texas Tech Red Folders 18. Texas Tech Red Folders 1 pt. 0
  1. Avatar for randomlil 21. randomlil Lv 1 49 pts. 9,314
  2. Avatar for mimi 22. mimi Lv 1 47 pts. 9,312
  3. Avatar for gitwut 23. gitwut Lv 1 45 pts. 9,311
  4. Avatar for johnmitch 24. johnmitch Lv 1 43 pts. 9,310
  5. Avatar for O Seki To 25. O Seki To Lv 1 42 pts. 9,300
  6. Avatar for kabubi 26. kabubi Lv 1 40 pts. 9,293
  7. Avatar for nicobul 27. nicobul Lv 1 39 pts. 9,292
  8. Avatar for anthion 28. anthion Lv 1 37 pts. 9,278
  9. Avatar for Bruno Kestemont 29. Bruno Kestemont Lv 1 36 pts. 9,275
  10. Avatar for actiasluna 30. actiasluna Lv 1 34 pts. 9,267

Comments