Placeholder image of a protein
Icon representing a puzzle

1393: Unsolved De-novo Freestyle 107

Closed since almost 9 years ago

Intermediate Overall Prediction

Summary


Created
June 20, 2017
Expires
Max points
100
Description

The structure of this protein is still unknown. Secondary structure predictions (from PSIPRED) are marked on the starting structure, and provide clues about where the protein might form helices and sheets!



Sequence:


EKDEKIMEEMKKLVEQVKKKGGRVRITIRKENGTVRIRVEVDVDGHDTTVEWEGGSDDVMEHVKQQLQEVKDQHN

Top groups


  1. Avatar for Anthropic Dreams 100 pts. 9,445
  2. Avatar for Beta Folders 2. Beta Folders 74 pts. 9,430
  3. Avatar for Void Crushers 3. Void Crushers 54 pts. 9,393
  4. Avatar for Marvin's bunch 4. Marvin's bunch 38 pts. 9,390
  5. Avatar for Go Science 5. Go Science 27 pts. 9,372
  6. Avatar for Contenders 6. Contenders 18 pts. 9,369
  7. Avatar for Gargleblasters 7. Gargleblasters 12 pts. 9,347
  8. Avatar for HMT heritage 8. HMT heritage 8 pts. 9,300
  9. Avatar for L'Alliance Francophone 9. L'Alliance Francophone 5 pts. 9,292
  10. Avatar for xkcd 10. xkcd 3 pts. 9,225

  1. Avatar for fiendish_ghoul
    1. fiendish_ghoul Lv 1
    100 pts. 9,451
  2. Avatar for Galaxie 2. Galaxie Lv 1 97 pts. 9,444
  3. Avatar for retiredmichael 3. retiredmichael Lv 1 94 pts. 9,429
  4. Avatar for markm457 4. markm457 Lv 1 91 pts. 9,402
  5. Avatar for bertro 5. bertro Lv 1 88 pts. 9,401
  6. Avatar for tokens 6. tokens Lv 1 85 pts. 9,398
  7. Avatar for Timo van der Laan 7. Timo van der Laan Lv 1 82 pts. 9,393
  8. Avatar for frood66 8. frood66 Lv 1 79 pts. 9,387
  9. Avatar for Wilm 9. Wilm Lv 1 76 pts. 9,372
  10. Avatar for LociOiling 10. LociOiling Lv 1 74 pts. 9,372

Comments