Placeholder image of a protein
Icon representing a puzzle

1393: Unsolved De-novo Freestyle 107

Closed since over 8 years ago

Intermediate Overall Prediction

Summary


Created
June 20, 2017
Expires
Max points
100
Description

The structure of this protein is still unknown. Secondary structure predictions (from PSIPRED) are marked on the starting structure, and provide clues about where the protein might form helices and sheets!



Sequence:


EKDEKIMEEMKKLVEQVKKKGGRVRITIRKENGTVRIRVEVDVDGHDTTVEWEGGSDDVMEHVKQQLQEVKDQHN

Top groups


  1. Avatar for Anthropic Dreams 100 pts. 9,445
  2. Avatar for Beta Folders 2. Beta Folders 74 pts. 9,430
  3. Avatar for Void Crushers 3. Void Crushers 54 pts. 9,393
  4. Avatar for Marvin's bunch 4. Marvin's bunch 38 pts. 9,390
  5. Avatar for Go Science 5. Go Science 27 pts. 9,372
  6. Avatar for Contenders 6. Contenders 18 pts. 9,369
  7. Avatar for Gargleblasters 7. Gargleblasters 12 pts. 9,347
  8. Avatar for HMT heritage 8. HMT heritage 8 pts. 9,300
  9. Avatar for L'Alliance Francophone 9. L'Alliance Francophone 5 pts. 9,292
  10. Avatar for xkcd 10. xkcd 3 pts. 9,225

  1. Avatar for retiredmichael 11. retiredmichael Lv 1 9 pts. 9,420
  2. Avatar for tokens 12. tokens Lv 1 7 pts. 9,418
  3. Avatar for jausmh 13. jausmh Lv 1 5 pts. 9,390
  4. Avatar for Bletchley Park 14. Bletchley Park Lv 1 4 pts. 9,369
  5. Avatar for georg137 15. georg137 Lv 1 3 pts. 9,367
  6. Avatar for mimi 16. mimi Lv 1 2 pts. 9,365
  7. Avatar for toshiue 17. toshiue Lv 1 1 pt. 9,350
  8. Avatar for actiasluna 18. actiasluna Lv 1 1 pt. 9,347
  9. Avatar for Bruno Kestemont 19. Bruno Kestemont Lv 1 1 pt. 9,347
  10. Avatar for Hollinas 20. Hollinas Lv 1 1 pt. 9,344

Comments