Placeholder image of a protein
Icon representing a puzzle

1393: Unsolved De-novo Freestyle 107

Closed since almost 9 years ago

Intermediate Intermediate Intermediate Intermediate Intermediate Intermediate Intermediate Intermediate Intermediate Overall Overall Overall Overall Overall Overall Overall Overall Overall Prediction Prediction Prediction Prediction Prediction Prediction Prediction Prediction Prediction

Summary


Created
June 20, 2017
Expires
Max points
100
Description

The structure of this protein is still unknown. Secondary structure predictions (from PSIPRED) are marked on the starting structure, and provide clues about where the protein might form helices and sheets!



Sequence:


EKDEKIMEEMKKLVEQVKKKGGRVRITIRKENGTVRIRVEVDVDGHDTTVEWEGGSDDVMEHVKQQLQEVKDQHN

Top groups


  1. Avatar for Anthropic Dreams 100 pts. 9,445
  2. Avatar for Beta Folders 2. Beta Folders 74 pts. 9,430
  3. Avatar for Void Crushers 3. Void Crushers 54 pts. 9,393
  4. Avatar for Marvin's bunch 4. Marvin's bunch 38 pts. 9,390
  5. Avatar for Go Science 5. Go Science 27 pts. 9,372
  6. Avatar for Contenders 6. Contenders 18 pts. 9,369
  7. Avatar for Gargleblasters 7. Gargleblasters 12 pts. 9,347
  8. Avatar for HMT heritage 8. HMT heritage 8 pts. 9,300
  9. Avatar for L'Alliance Francophone 9. L'Alliance Francophone 5 pts. 9,292
  10. Avatar for xkcd 10. xkcd 3 pts. 9,225

  1. Avatar for Anton Trikshev 111. Anton Trikshev Lv 1 1 pt. 8,307
  2. Avatar for Arne Heessels 112. Arne Heessels Lv 1 1 pt. 8,294
  3. Avatar for trentis1 113. trentis1 Lv 1 1 pt. 8,267
  4. Avatar for kamilko 114. kamilko Lv 1 1 pt. 8,171
  5. Avatar for JUMELLE54 115. JUMELLE54 Lv 1 1 pt. 8,085
  6. Avatar for lamoille 116. lamoille Lv 1 1 pt. 8,015
  7. Avatar for fpc 117. fpc Lv 1 1 pt. 7,909
  8. Avatar for pandapharmd 118. pandapharmd Lv 1 1 pt. 7,904
  9. Avatar for aspadistra 119. aspadistra Lv 1 1 pt. 7,841
  10. Avatar for a791412276 120. a791412276 Lv 1 1 pt. 7,816

Comments