Placeholder image of a protein
Icon representing a puzzle

1394: Revisiting Puzzle 117: Transport Mutant

Closed since almost 9 years ago

Intermediate Overall Prediction

Summary


Created
June 22, 2017
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This small protein participates in electron transfer reactions in the cell. The protein is modeled here in reduced form, so no disulfides are expected to form. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:

a
MKKYTCTVCGYIYNPEDGDPDNGVNPGTDFKDIPDDWVCPLCAVGKDQFEEVEE

Top groups


  1. Avatar for Natural Abilities 11. Natural Abilities 1 pt. 8,519
  2. Avatar for DSN @ Home 12. DSN @ Home 1 pt. 8,223
  3. Avatar for GUGITBIOTECH 13. GUGITBIOTECH 1 pt. 8,203
  4. Avatar for Team South Africa 15. Team South Africa 1 pt. 8,091
  5. Avatar for Deleted group 16. Deleted group pts. 7,509
  6. Avatar for test_group1 17. test_group1 1 pt. 0

  1. Avatar for O Seki To
    1. O Seki To Lv 1
    100 pts. 8,848
  2. Avatar for Bruno Kestemont 2. Bruno Kestemont Lv 1 97 pts. 8,847
  3. Avatar for markm457 3. markm457 Lv 1 93 pts. 8,842
  4. Avatar for gitwut 4. gitwut Lv 1 90 pts. 8,839
  5. Avatar for smilingone 5. smilingone Lv 1 87 pts. 8,835
  6. Avatar for Galaxie 6. Galaxie Lv 1 84 pts. 8,832
  7. Avatar for dcrwheeler 7. dcrwheeler Lv 1 80 pts. 8,830
  8. Avatar for jermainiac 8. jermainiac Lv 1 77 pts. 8,829
  9. Avatar for retiredmichael 9. retiredmichael Lv 1 75 pts. 8,825
  10. Avatar for actiasluna 10. actiasluna Lv 1 72 pts. 8,818

Comments