Placeholder image of a protein
Icon representing a puzzle

1394: Revisiting Puzzle 117: Transport Mutant

Closed since almost 9 years ago

Intermediate Overall Prediction

Summary


Created
June 22, 2017
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This small protein participates in electron transfer reactions in the cell. The protein is modeled here in reduced form, so no disulfides are expected to form. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:

a
MKKYTCTVCGYIYNPEDGDPDNGVNPGTDFKDIPDDWVCPLCAVGKDQFEEVEE

Top groups


  1. Avatar for Contenders 100 pts. 8,848
  2. Avatar for Go Science 2. Go Science 73 pts. 8,848
  3. Avatar for HMT heritage 3. HMT heritage 52 pts. 8,848
  4. Avatar for Anthropic Dreams 4. Anthropic Dreams 36 pts. 8,844
  5. Avatar for Beta Folders 5. Beta Folders 24 pts. 8,841
  6. Avatar for Gargleblasters 6. Gargleblasters 16 pts. 8,818
  7. Avatar for Void Crushers 7. Void Crushers 10 pts. 8,816
  8. Avatar for L'Alliance Francophone 8. L'Alliance Francophone 6 pts. 8,786
  9. Avatar for Marvin's bunch 9. Marvin's bunch 4 pts. 8,757
  10. Avatar for Italiani Al Lavoro 10. Italiani Al Lavoro 2 pts. 8,754

  1. Avatar for O Seki To
    1. O Seki To Lv 1
    100 pts. 8,848
  2. Avatar for Bruno Kestemont 2. Bruno Kestemont Lv 1 97 pts. 8,847
  3. Avatar for markm457 3. markm457 Lv 1 93 pts. 8,842
  4. Avatar for gitwut 4. gitwut Lv 1 90 pts. 8,839
  5. Avatar for smilingone 5. smilingone Lv 1 87 pts. 8,835
  6. Avatar for Galaxie 6. Galaxie Lv 1 84 pts. 8,832
  7. Avatar for dcrwheeler 7. dcrwheeler Lv 1 80 pts. 8,830
  8. Avatar for jermainiac 8. jermainiac Lv 1 77 pts. 8,829
  9. Avatar for retiredmichael 9. retiredmichael Lv 1 75 pts. 8,825
  10. Avatar for actiasluna 10. actiasluna Lv 1 72 pts. 8,818

Comments