Placeholder image of a protein
Icon representing a puzzle

1394: Revisiting Puzzle 117: Transport Mutant

Closed since over 8 years ago

Intermediate Overall Prediction

Summary

Created
June 22, 2017
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This small protein participates in electron transfer reactions in the cell. The protein is modeled here in reduced form, so no disulfides are expected to form. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:

a
MKKYTCTVCGYIYNPEDGDPDNGVNPGTDFKDIPDDWVCPLCAVGKDQFEEVEE

Top groups

  1. Avatar for Natural Abilities 11. Natural Abilities 1 pt. 8,519
  2. Avatar for DSN @ Home 12. DSN @ Home 1 pt. 8,223
  3. Avatar for GUGITBIOTECH 13. GUGITBIOTECH 1 pt. 8,203
  4. Avatar for Richard Dawkins Foundation 14. Richard Dawkins Foundation 1 pt. 8,109
  5. Avatar for Team South Africa 15. Team South Africa 1 pt. 8,091
  6. Avatar for Deleted group 16. Deleted group pts. 7,509
  7. Avatar for test_group1 17. test_group1 1 pt. 0
  1. Avatar for ucvcxc 131. ucvcxc Lv 1 1 pt. 7,291
  2. Avatar for 01010011111 132. 01010011111 Lv 1 1 pt. 7,028
  3. Avatar for potatopotatopotato 133. potatopotatopotato Lv 1 1 pt. 6,238
  4. Avatar for test_account1 134. test_account1 Lv 1 1 pt. 0
  5. Avatar for Hollinas 135. Hollinas Lv 1 1 pt. 0
  6. Avatar for Neo_Ni 136. Neo_Ni Lv 1 1 pt. 0
  7. Avatar for eromana 137. eromana Lv 1 1 pt. 0
  8. Avatar for dettingen 138. dettingen Lv 1 1 pt. 0

Comments