Placeholder image of a protein
Icon representing a puzzle

1394: Revisiting Puzzle 117: Transport Mutant

Closed since almost 9 years ago

Intermediate Intermediate Overall Overall Prediction Prediction

Summary


Created
June 22, 2017
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This small protein participates in electron transfer reactions in the cell. The protein is modeled here in reduced form, so no disulfides are expected to form. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:

a
MKKYTCTVCGYIYNPEDGDPDNGVNPGTDFKDIPDDWVCPLCAVGKDQFEEVEE

Top groups


  1. Avatar for Contenders 100 pts. 8,848
  2. Avatar for Go Science 2. Go Science 73 pts. 8,848
  3. Avatar for HMT heritage 3. HMT heritage 52 pts. 8,848
  4. Avatar for Anthropic Dreams 4. Anthropic Dreams 36 pts. 8,844
  5. Avatar for Beta Folders 5. Beta Folders 24 pts. 8,841
  6. Avatar for Gargleblasters 6. Gargleblasters 16 pts. 8,818
  7. Avatar for Void Crushers 7. Void Crushers 10 pts. 8,816
  8. Avatar for L'Alliance Francophone 8. L'Alliance Francophone 6 pts. 8,786
  9. Avatar for Marvin's bunch 9. Marvin's bunch 4 pts. 8,757
  10. Avatar for Italiani Al Lavoro 10. Italiani Al Lavoro 2 pts. 8,754

  1. Avatar for ucvcxc 131. ucvcxc Lv 1 1 pt. 7,291
  2. Avatar for 01010011111 132. 01010011111 Lv 1 1 pt. 7,028
  3. Avatar for potatopotatopotato 133. potatopotatopotato Lv 1 1 pt. 6,238
  4. Avatar for Hollinas 135. Hollinas Lv 1 1 pt. 0
  5. Avatar for Neo_Ni 136. Neo_Ni Lv 1 1 pt. 0
  6. Avatar for eromana 137. eromana Lv 1 1 pt. 0
  7. Avatar for dettingen 138. dettingen Lv 1 1 pt. 0

Comments