Placeholder image of a protein
Icon representing a puzzle

1394: Revisiting Puzzle 117: Transport Mutant

Closed since almost 9 years ago

Intermediate Overall Prediction

Summary


Created
June 22, 2017
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This small protein participates in electron transfer reactions in the cell. The protein is modeled here in reduced form, so no disulfides are expected to form. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:

a
MKKYTCTVCGYIYNPEDGDPDNGVNPGTDFKDIPDDWVCPLCAVGKDQFEEVEE

Top groups


  1. Avatar for Contenders 100 pts. 8,848
  2. Avatar for Go Science 2. Go Science 73 pts. 8,848
  3. Avatar for HMT heritage 3. HMT heritage 52 pts. 8,848
  4. Avatar for Anthropic Dreams 4. Anthropic Dreams 36 pts. 8,844
  5. Avatar for Beta Folders 5. Beta Folders 24 pts. 8,841
  6. Avatar for Gargleblasters 6. Gargleblasters 16 pts. 8,818
  7. Avatar for Void Crushers 7. Void Crushers 10 pts. 8,816
  8. Avatar for L'Alliance Francophone 8. L'Alliance Francophone 6 pts. 8,786
  9. Avatar for Marvin's bunch 9. Marvin's bunch 4 pts. 8,757
  10. Avatar for Italiani Al Lavoro 10. Italiani Al Lavoro 2 pts. 8,754

  1. Avatar for SKSbell 61. SKSbell Lv 1 6 pts. 8,718
  2. Avatar for Deleted player 62. Deleted player 6 pts. 8,708
  3. Avatar for jamiexq 63. jamiexq Lv 1 5 pts. 8,704
  4. Avatar for alcor29 64. alcor29 Lv 1 5 pts. 8,701
  5. Avatar for altejoh 65. altejoh Lv 1 5 pts. 8,695
  6. Avatar for YeshuaLives 66. YeshuaLives Lv 1 5 pts. 8,682
  7. Avatar for Deleted player 67. Deleted player pts. 8,677
  8. Avatar for Flagg65a 68. Flagg65a Lv 1 4 pts. 8,676
  9. Avatar for ZeroLeak7 69. ZeroLeak7 Lv 1 4 pts. 8,674
  10. Avatar for Deleted player 70. Deleted player pts. 8,661

Comments