Placeholder image of a protein
Icon representing a puzzle

1394: Revisiting Puzzle 117: Transport Mutant

Closed since almost 9 years ago

Intermediate Intermediate Intermediate Intermediate Intermediate Intermediate Intermediate Intermediate Intermediate Overall Overall Overall Overall Overall Overall Overall Overall Overall Prediction Prediction Prediction Prediction Prediction Prediction Prediction Prediction Prediction

Summary


Created
June 22, 2017
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This small protein participates in electron transfer reactions in the cell. The protein is modeled here in reduced form, so no disulfides are expected to form. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:

a
MKKYTCTVCGYIYNPEDGDPDNGVNPGTDFKDIPDDWVCPLCAVGKDQFEEVEE

Top groups


  1. Avatar for Contenders 100 pts. 8,848
  2. Avatar for Go Science 2. Go Science 73 pts. 8,848
  3. Avatar for HMT heritage 3. HMT heritage 52 pts. 8,848
  4. Avatar for Anthropic Dreams 4. Anthropic Dreams 36 pts. 8,844
  5. Avatar for Beta Folders 5. Beta Folders 24 pts. 8,841
  6. Avatar for Gargleblasters 6. Gargleblasters 16 pts. 8,818
  7. Avatar for Void Crushers 7. Void Crushers 10 pts. 8,816
  8. Avatar for L'Alliance Francophone 8. L'Alliance Francophone 6 pts. 8,786
  9. Avatar for Marvin's bunch 9. Marvin's bunch 4 pts. 8,757
  10. Avatar for Italiani Al Lavoro 10. Italiani Al Lavoro 2 pts. 8,754

  1. Avatar for smcclosk 121. smcclosk Lv 1 1 pt. 8,088
  2. Avatar for lamoille 122. lamoille Lv 1 1 pt. 8,039
  3. Avatar for justjustin 123. justjustin Lv 1 1 pt. 8,038
  4. Avatar for a791412276 124. a791412276 Lv 1 1 pt. 8,025
  5. Avatar for alwen 125. alwen Lv 1 1 pt. 8,006
  6. Avatar for momadoc 126. momadoc Lv 1 1 pt. 7,982
  7. Avatar for parsnip 127. parsnip Lv 1 1 pt. 7,927
  8. Avatar for susithran 128. susithran Lv 1 1 pt. 7,881
  9. Avatar for Deadpool31 129. Deadpool31 Lv 1 1 pt. 7,809
  10. Avatar for Erica_W 130. Erica_W Lv 1 1 pt. 7,509

Comments