Placeholder image of a protein
Icon representing a puzzle

1396: Unsolved De-novo Freestyle 108

Closed since almost 9 years ago

Intermediate Intermediate Intermediate Intermediate Intermediate Intermediate Overall Overall Overall Overall Overall Overall Prediction Prediction Prediction Prediction Prediction Prediction

Summary


Created
June 27, 2017
Expires
Max points
100
Description

The structure of this protein is still unknown. Secondary structure predictions (from PSIPRED) are marked on the starting structure, and provide clues about where the protein might form helices and sheets!



Sequence:


STDDEVEKLREEVQRKGGKVEVKKENGKHKVRVKFETENKTVELTVTNEEQVKRMQKQVEEQIKK

Top groups


  1. Avatar for Deleted group 11. Deleted group pts. 8,946
  2. Avatar for xkcd 12. xkcd 2 pts. 8,761
  3. Avatar for Natural Abilities 13. Natural Abilities 2 pts. 8,752
  4. Avatar for Russian team 14. Russian team 1 pt. 8,750
  5. Avatar for Italiani Al Lavoro 15. Italiani Al Lavoro 1 pt. 8,694
  6. Avatar for GC Sommerlejr 2017 16. GC Sommerlejr 2017 1 pt. 8,667
  7. Avatar for Deleted group 17. Deleted group pts. 7,970
  8. Avatar for SciOne2017 18. SciOne2017 1 pt. 7,442
  9. Avatar for Deleted group 20. Deleted group pts. 5,517

  1. Avatar for actiasluna
    1. actiasluna Lv 1
    100 pts. 9,283
  2. Avatar for Skippysk8s 2. Skippysk8s Lv 1 97 pts. 9,281
  3. Avatar for anthion 3. anthion Lv 1 94 pts. 9,251
  4. Avatar for Wilm 4. Wilm Lv 1 91 pts. 9,248
  5. Avatar for markm457 5. markm457 Lv 1 88 pts. 9,212
  6. Avatar for caglar 6. caglar Lv 1 85 pts. 9,211
  7. Avatar for ZeroLeak7 7. ZeroLeak7 Lv 1 82 pts. 9,211
  8. Avatar for reefyrob 8. reefyrob Lv 1 80 pts. 9,208
  9. Avatar for fiendish_ghoul 9. fiendish_ghoul Lv 1 77 pts. 9,205
  10. Avatar for Susume 10. Susume Lv 1 74 pts. 9,201

Comments