Placeholder image of a protein
Icon representing a puzzle

1396: Unsolved De-novo Freestyle 108

Closed since over 8 years ago

Intermediate Overall Prediction

Summary

Created
June 27, 2017
Expires
Max points
100
Description

The structure of this protein is still unknown. Secondary structure predictions (from PSIPRED) are marked on the starting structure, and provide clues about where the protein might form helices and sheets!



Sequence:


STDDEVEKLREEVQRKGGKVEVKKENGKHKVRVKFETENKTVELTVTNEEQVKRMQKQVEEQIKK

Top groups

  1. Avatar for Window Group 21. Window Group 1 pt. 0
  1. Avatar for actiasluna
    1. actiasluna Lv 1
    100 pts. 9,283
  2. Avatar for Skippysk8s 2. Skippysk8s Lv 1 97 pts. 9,281
  3. Avatar for anthion 3. anthion Lv 1 94 pts. 9,251
  4. Avatar for Wilm 4. Wilm Lv 1 91 pts. 9,248
  5. Avatar for markm457 5. markm457 Lv 1 88 pts. 9,212
  6. Avatar for caglar 6. caglar Lv 1 85 pts. 9,211
  7. Avatar for ZeroLeak7 7. ZeroLeak7 Lv 1 82 pts. 9,211
  8. Avatar for reefyrob 8. reefyrob Lv 1 80 pts. 9,208
  9. Avatar for fiendish_ghoul 9. fiendish_ghoul Lv 1 77 pts. 9,205
  10. Avatar for Susume 10. Susume Lv 1 74 pts. 9,201

Comments