Placeholder image of a protein
Icon representing a puzzle

1396: Unsolved De-novo Freestyle 108

Closed since almost 9 years ago

Intermediate Overall Prediction

Summary

Created
June 27, 2017
Expires
Max points
100
Description

The structure of this protein is still unknown. Secondary structure predictions (from PSIPRED) are marked on the starting structure, and provide clues about where the protein might form helices and sheets!



Sequence:


STDDEVEKLREEVQRKGGKVEVKKENGKHKVRVKFETENKTVELTVTNEEQVKRMQKQVEEQIKK

Top groups

  1. Avatar for Deleted group 11. Deleted group pts. 8,946
  2. Avatar for xkcd 12. xkcd 2 pts. 8,761
  3. Avatar for Natural Abilities 13. Natural Abilities 2 pts. 8,752
  4. Avatar for Russian team 14. Russian team 1 pt. 8,750
  5. Avatar for Italiani Al Lavoro 15. Italiani Al Lavoro 1 pt. 8,694
  6. Avatar for GC Sommerlejr 2017 16. GC Sommerlejr 2017 1 pt. 8,667
  7. Avatar for Deleted group 17. Deleted group pts. 7,970
  8. Avatar for SciOne2017 18. SciOne2017 1 pt. 7,442
  9. Avatar for Topics in Bioscience and Biotech 19. Topics in Bioscience and Biotech 1 pt. 7,215
  10. Avatar for Deleted group 20. Deleted group pts. 5,517
  1. Avatar for Miguel angel 141. Miguel angel Lv 1 1 pt. 6,296
  2. Avatar for Ramisaa 142. Ramisaa Lv 1 1 pt. 6,239
  3. Avatar for ChrisTrue 143. ChrisTrue Lv 1 1 pt. 6,215
  4. Avatar for Naxaramas 144. Naxaramas Lv 1 1 pt. 6,184
  5. Avatar for robkleffner 145. robkleffner Lv 1 1 pt. 5,960
  6. Avatar for ojiman0464 146. ojiman0464 Lv 1 1 pt. 5,790
  7. Avatar for jflat06 147. jflat06 Lv 1 1 pt. 0
  8. Avatar for potatopotatopotato 148. potatopotatopotato Lv 1 1 pt. 0
  9. Avatar for OswaldoP 149. OswaldoP Lv 1 1 pt. 0
  10. Avatar for dnskkh 150. dnskkh Lv 1 1 pt. 0

Comments