Placeholder image of a protein
Icon representing a puzzle

1396: Unsolved De-novo Freestyle 108

Closed since almost 9 years ago

Intermediate Overall Prediction

Summary

Created
June 27, 2017
Expires
Max points
100
Description

The structure of this protein is still unknown. Secondary structure predictions (from PSIPRED) are marked on the starting structure, and provide clues about where the protein might form helices and sheets!



Sequence:


STDDEVEKLREEVQRKGGKVEVKKENGKHKVRVKFETENKTVELTVTNEEQVKRMQKQVEEQIKK

Top groups

  1. Avatar for Deleted group 11. Deleted group pts. 8,946
  2. Avatar for xkcd 12. xkcd 2 pts. 8,761
  3. Avatar for Natural Abilities 13. Natural Abilities 2 pts. 8,752
  4. Avatar for Russian team 14. Russian team 1 pt. 8,750
  5. Avatar for Italiani Al Lavoro 15. Italiani Al Lavoro 1 pt. 8,694
  6. Avatar for GC Sommerlejr 2017 16. GC Sommerlejr 2017 1 pt. 8,667
  7. Avatar for Deleted group 17. Deleted group pts. 7,970
  8. Avatar for SciOne2017 18. SciOne2017 1 pt. 7,442
  9. Avatar for Topics in Bioscience and Biotech 19. Topics in Bioscience and Biotech 1 pt. 7,215
  10. Avatar for Deleted group 20. Deleted group pts. 5,517
  1. Avatar for retiredmichael 11. retiredmichael Lv 1 72 pts. 9,198
  2. Avatar for Blipperman 12. Blipperman Lv 1 69 pts. 9,197
  3. Avatar for Bruno Kestemont 13. Bruno Kestemont Lv 1 67 pts. 9,194
  4. Avatar for frood66 14. frood66 Lv 1 65 pts. 9,194
  5. Avatar for Galaxie 15. Galaxie Lv 1 62 pts. 9,186
  6. Avatar for eusair 16. eusair Lv 1 60 pts. 9,186
  7. Avatar for gitwut 17. gitwut Lv 1 58 pts. 9,178
  8. Avatar for jobo0502 18. jobo0502 Lv 1 56 pts. 9,162
  9. Avatar for Deleted player 19. Deleted player pts. 9,158
  10. Avatar for Timo van der Laan 20. Timo van der Laan Lv 1 52 pts. 9,155

Comments