Placeholder image of a protein
Icon representing a puzzle

1396: Unsolved De-novo Freestyle 108

Closed since almost 9 years ago

Intermediate Overall Prediction

Summary

Created
June 27, 2017
Expires
Max points
100
Description

The structure of this protein is still unknown. Secondary structure predictions (from PSIPRED) are marked on the starting structure, and provide clues about where the protein might form helices and sheets!



Sequence:


STDDEVEKLREEVQRKGGKVEVKKENGKHKVRVKFETENKTVELTVTNEEQVKRMQKQVEEQIKK

Top groups

  1. Avatar for Deleted group 11. Deleted group pts. 8,946
  2. Avatar for xkcd 12. xkcd 2 pts. 8,761
  3. Avatar for Natural Abilities 13. Natural Abilities 2 pts. 8,752
  4. Avatar for Russian team 14. Russian team 1 pt. 8,750
  5. Avatar for Italiani Al Lavoro 15. Italiani Al Lavoro 1 pt. 8,694
  6. Avatar for GC Sommerlejr 2017 16. GC Sommerlejr 2017 1 pt. 8,667
  7. Avatar for Deleted group 17. Deleted group pts. 7,970
  8. Avatar for SciOne2017 18. SciOne2017 1 pt. 7,442
  9. Avatar for Topics in Bioscience and Biotech 19. Topics in Bioscience and Biotech 1 pt. 7,215
  10. Avatar for Deleted group 20. Deleted group pts. 5,517
  1. Avatar for heather-1 41. heather-1 Lv 1 22 pts. 9,075
  2. Avatar for randomlil 42. randomlil Lv 1 22 pts. 9,072
  3. Avatar for grogar7 43. grogar7 Lv 1 21 pts. 9,072
  4. Avatar for tarimo 44. tarimo Lv 1 20 pts. 9,065
  5. Avatar for Anfinsen_slept_here 45. Anfinsen_slept_here Lv 1 19 pts. 9,060
  6. Avatar for Deleted player 46. Deleted player pts. 9,060
  7. Avatar for guineapig 47. guineapig Lv 1 17 pts. 9,058
  8. Avatar for lupussapien 48. lupussapien Lv 1 16 pts. 9,058
  9. Avatar for tony46 49. tony46 Lv 1 16 pts. 9,055
  10. Avatar for toshiue 50. toshiue Lv 1 15 pts. 9,052

Comments