Placeholder image of a protein
Icon representing a puzzle

1396: Unsolved De-novo Freestyle 108

Closed since almost 9 years ago

Intermediate Overall Prediction

Summary

Created
June 27, 2017
Expires
Max points
100
Description

The structure of this protein is still unknown. Secondary structure predictions (from PSIPRED) are marked on the starting structure, and provide clues about where the protein might form helices and sheets!



Sequence:


STDDEVEKLREEVQRKGGKVEVKKENGKHKVRVKFETENKTVELTVTNEEQVKRMQKQVEEQIKK

Top groups

  1. Avatar for Deleted group 11. Deleted group pts. 8,946
  2. Avatar for xkcd 12. xkcd 2 pts. 8,761
  3. Avatar for Natural Abilities 13. Natural Abilities 2 pts. 8,752
  4. Avatar for Russian team 14. Russian team 1 pt. 8,750
  5. Avatar for Italiani Al Lavoro 15. Italiani Al Lavoro 1 pt. 8,694
  6. Avatar for GC Sommerlejr 2017 16. GC Sommerlejr 2017 1 pt. 8,667
  7. Avatar for Deleted group 17. Deleted group pts. 7,970
  8. Avatar for SciOne2017 18. SciOne2017 1 pt. 7,442
  9. Avatar for Topics in Bioscience and Biotech 19. Topics in Bioscience and Biotech 1 pt. 7,215
  10. Avatar for Deleted group 20. Deleted group pts. 5,517
  1. Avatar for Deleted player 71. Deleted player pts. 8,901
  2. Avatar for Marvelz 72. Marvelz Lv 1 5 pts. 8,899
  3. Avatar for fishercat 73. fishercat Lv 1 5 pts. 8,898
  4. Avatar for SKSbell 74. SKSbell Lv 1 4 pts. 8,876
  5. Avatar for FractalCuber 75. FractalCuber Lv 1 4 pts. 8,873
  6. Avatar for andrewtmaxwell 76. andrewtmaxwell Lv 1 4 pts. 8,864
  7. Avatar for Bautho 77. Bautho Lv 1 4 pts. 8,840
  8. Avatar for Anton Trikshev 78. Anton Trikshev Lv 1 4 pts. 8,839
  9. Avatar for uihcv 79. uihcv Lv 1 3 pts. 8,837
  10. Avatar for tomespen 80. tomespen Lv 1 3 pts. 8,825

Comments