Placeholder image of a protein
Icon representing a puzzle

1396: Unsolved De-novo Freestyle 108

Closed since almost 9 years ago

Intermediate Overall Prediction

Summary


Created
June 27, 2017
Expires
Max points
100
Description

The structure of this protein is still unknown. Secondary structure predictions (from PSIPRED) are marked on the starting structure, and provide clues about where the protein might form helices and sheets!



Sequence:


STDDEVEKLREEVQRKGGKVEVKKENGKHKVRVKFETENKTVELTVTNEEQVKRMQKQVEEQIKK

Top groups


  1. Avatar for Window Group 21. Window Group 1 pt. 0

  1. Avatar for heather-1 41. heather-1 Lv 1 22 pts. 9,075
  2. Avatar for randomlil 42. randomlil Lv 1 22 pts. 9,072
  3. Avatar for grogar7 43. grogar7 Lv 1 21 pts. 9,072
  4. Avatar for tarimo 44. tarimo Lv 1 20 pts. 9,065
  5. Avatar for Anfinsen_slept_here 45. Anfinsen_slept_here Lv 1 19 pts. 9,060
  6. Avatar for Deleted player 46. Deleted player pts. 9,060
  7. Avatar for guineapig 47. guineapig Lv 1 17 pts. 9,058
  8. Avatar for lupussapien 48. lupussapien Lv 1 16 pts. 9,058
  9. Avatar for tony46 49. tony46 Lv 1 16 pts. 9,055
  10. Avatar for toshiue 50. toshiue Lv 1 15 pts. 9,052

Comments