Placeholder image of a protein
Icon representing a puzzle

1396: Unsolved De-novo Freestyle 108

Closed since almost 9 years ago

Intermediate Overall Prediction

Summary

Created
June 27, 2017
Expires
Max points
100
Description

The structure of this protein is still unknown. Secondary structure predictions (from PSIPRED) are marked on the starting structure, and provide clues about where the protein might form helices and sheets!



Sequence:


STDDEVEKLREEVQRKGGKVEVKKENGKHKVRVKFETENKTVELTVTNEEQVKRMQKQVEEQIKK

Top groups

  1. Avatar for Window Group 21. Window Group 1 pt. 0
  1. Avatar for NinjaGreg 51. NinjaGreg Lv 1 14 pts. 9,051
  2. Avatar for hansvandenhof 52. hansvandenhof Lv 1 14 pts. 9,051
  3. Avatar for phi16 53. phi16 Lv 1 13 pts. 9,045
  4. Avatar for dssb 54. dssb Lv 1 12 pts. 9,045
  5. Avatar for WBarme1234 55. WBarme1234 Lv 1 12 pts. 9,043
  6. Avatar for harvardman 56. harvardman Lv 1 11 pts. 9,041
  7. Avatar for dizzywings 57. dizzywings Lv 1 11 pts. 9,011
  8. Avatar for TastyMunchies 58. TastyMunchies Lv 1 10 pts. 8,990
  9. Avatar for YeshuaLives 59. YeshuaLives Lv 1 10 pts. 8,980
  10. Avatar for Bletchley Park 60. Bletchley Park Lv 1 9 pts. 8,978

Comments