Placeholder image of a protein
Icon representing a puzzle

1397: Revisiting Puzzle 124: PDZ Domain

Closed since almost 9 years ago

Intermediate Overall Prediction

Summary

Created
June 29, 2017
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This domain is a component of many proteins involved in cell signaling. The protein is modeled here in reduced form, so no disulfides are expected to form. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


SMVPGKVTLQKDAQNLIGISIGGGAQPCLYIVQVFDNTPAALDGTVAAGDEITGVNGRSIKGKTKVEVAKMIQEVKGEVTIHYNKLQYYKV

Top groups

  1. Avatar for Italiani Al Lavoro 11. Italiani Al Lavoro 2 pts. 9,137
  2. Avatar for xkcd 12. xkcd 1 pt. 8,959
  3. Avatar for Russian team 13. Russian team 1 pt. 8,934
  4. Avatar for Natural Abilities 14. Natural Abilities 1 pt. 8,844
  5. Avatar for Deleted group 15. Deleted group pts. 8,549
  6. Avatar for Team South Africa 16. Team South Africa 1 pt. 8,469
  7. Avatar for GUGITBIOTECH 17. GUGITBIOTECH 1 pt. 8,468
  8. Avatar for BIO257C 18. BIO257C 1 pt. 8,425
  9. Avatar for Window Group 19. Window Group 1 pt. 8,328
  1. Avatar for Blipperman 41. Blipperman Lv 1 21 pts. 9,211
  2. Avatar for Hiro Protagonist 42. Hiro Protagonist Lv 1 21 pts. 9,209
  3. Avatar for tokens 43. tokens Lv 1 20 pts. 9,208
  4. Avatar for Glen B 44. Glen B Lv 1 19 pts. 9,205
  5. Avatar for YeshuaLives 45. YeshuaLives Lv 1 18 pts. 9,204
  6. Avatar for pvc78 46. pvc78 Lv 1 17 pts. 9,201
  7. Avatar for weitzen 47. weitzen Lv 1 16 pts. 9,197
  8. Avatar for Mike Cassidy 48. Mike Cassidy Lv 1 16 pts. 9,191
  9. Avatar for cobaltteal 49. cobaltteal Lv 1 15 pts. 9,180
  10. Avatar for guineapig 50. guineapig Lv 1 14 pts. 9,176

Comments