Placeholder image of a protein
Icon representing a puzzle

1397: Revisiting Puzzle 124: PDZ Domain

Closed since over 8 years ago

Intermediate Overall Prediction

Summary

Created
June 29, 2017
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This domain is a component of many proteins involved in cell signaling. The protein is modeled here in reduced form, so no disulfides are expected to form. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


SMVPGKVTLQKDAQNLIGISIGGGAQPCLYIVQVFDNTPAALDGTVAAGDEITGVNGRSIKGKTKVEVAKMIQEVKGEVTIHYNKLQYYKV

Top groups

  1. Avatar for Beta Folders
    1. Beta Folders
    100 pts. 9,470
  2. Avatar for Anthropic Dreams 2. Anthropic Dreams 76 pts. 9,437
  3. Avatar for Contenders 3. Contenders 56 pts. 9,413
  4. Avatar for Gargleblasters 4. Gargleblasters 41 pts. 9,409
  5. Avatar for Void Crushers 5. Void Crushers 29 pts. 9,394
  6. Avatar for Go Science 6. Go Science 20 pts. 9,390
  7. Avatar for Marvin's bunch 7. Marvin's bunch 14 pts. 9,371
  8. Avatar for HMT heritage 8. HMT heritage 9 pts. 9,351
  9. Avatar for L'Alliance Francophone 9. L'Alliance Francophone 6 pts. 9,302
  10. Avatar for FoldIt@Netherlands 10. FoldIt@Netherlands 4 pts. 9,209
  1. Avatar for Blipperman 41. Blipperman Lv 1 21 pts. 9,211
  2. Avatar for Hiro Protagonist 42. Hiro Protagonist Lv 1 21 pts. 9,209
  3. Avatar for tokens 43. tokens Lv 1 20 pts. 9,208
  4. Avatar for Glen B 44. Glen B Lv 1 19 pts. 9,205
  5. Avatar for YeshuaLives 45. YeshuaLives Lv 1 18 pts. 9,204
  6. Avatar for pvc78 46. pvc78 Lv 1 17 pts. 9,201
  7. Avatar for weitzen 47. weitzen Lv 1 16 pts. 9,197
  8. Avatar for Mike Cassidy 48. Mike Cassidy Lv 1 16 pts. 9,191
  9. Avatar for cobaltteal 49. cobaltteal Lv 1 15 pts. 9,180
  10. Avatar for guineapig 50. guineapig Lv 1 14 pts. 9,176

Comments